KEGG   Pan paniscus (bonobo): 100968729Help
Entry
100968729         CDS       T02283                                 

Gene name
CHMP1A
Definition
(RefSeq) charged multivesicular body protein 1A
  KO
K12197  charged multivesicular body protein 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04144  Endocytosis
pps04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100968729 (CHMP1A)
  09143 Cell growth and death
   04217 Necroptosis
    100968729 (CHMP1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100968729 (CHMP1A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100968729 (CHMP1A)
Membrane trafficking [BR:pps04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    100968729 (CHMP1A)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100968729 (CHMP1A)
  Exosomal proteins of other body fluids (saliva and urine)
   100968729 (CHMP1A)
  Exosomal proteins of colorectal cancer cells
   100968729 (CHMP1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Snf7 MS_channel Ist1 DMSP_lyase
Motif
Other DBs
NCBI-GeneID: 100968729
NCBI-ProteinID: XP_014197380
UniProt: A0A2R9AMQ0
Position
16
AA seq 196 aa AA seqDB search
MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALLQKNVECARVYAENAIRKKNEGV
NWLRMASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSTMDLQKVSSVMDRFEQQVQ
NLDVHTSVMEDSMSSATTLTTPQEQVDSLIMQIAEENGLEVLDQLSQLPEGASAVGESSV
RSQEDQLSRRLAALRN
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggacgataccctgttccagttgaagttcacggcgaagcagctggagaagctggccaag
aaggcggagaaggactccaaggcggagcaggccaaagtgaagaaggcccttctgcagaaa
aatgtagagtgtgcccgtgtgtatgccgagaatgccatccgcaagaagaacgaaggtgtg
aactggcttcggatggcgtcccgcgtagacgcagtggcctccaaggtgcagacagctgtg
actatgaagggggtgaccaagaatatggcccaggtgaccaaagccctggacaaggccctg
agcaccatggacctgcagaaggtctcctcagtgatggacaggttcgagcagcaggtgcag
aacctggacgtccatacatcggtgatggaggactccatgagctcggccaccaccctgacc
acgccgcaggagcaggtggacagtctcatcatgcagatcgccgaggagaatggcctggag
gtgctggaccagctcagccagctgcccgagggcgcctctgccgtgggcgagagctctgtg
cgcagccaggaggaccagctgtcacggaggttggccgccttgaggaactag

DBGET integrated database retrieval system