KEGG   Pan paniscus (bonobo): 100968756
Entry
100968756         CDS       T02283                                 

Gene name
MDM2
Definition
(RefSeq) MDM2 proto-oncogene
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01522  Endocrine resistance
pps01524  Platinum drug resistance
pps04068  FoxO signaling pathway
pps04110  Cell cycle
pps04115  p53 signaling pathway
pps04120  Ubiquitin mediated proteolysis
pps04144  Endocytosis
pps04151  PI3K-Akt signaling pathway
pps04218  Cellular senescence
pps04625  C-type lectin receptor signaling pathway
pps04919  Thyroid hormone signaling pathway
pps05163  Human cytomegalovirus infection
pps05165  Human papillomavirus infection
pps05169  Epstein-Barr virus infection
pps05200  Pathways in cancer
pps05202  Transcriptional misregulation in cancer
pps05203  Viral carcinogenesis
pps05205  Proteoglycans in cancer
pps05206  MicroRNAs in cancer
pps05214  Glioma
pps05215  Prostate cancer
pps05218  Melanoma
pps05219  Bladder cancer
pps05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:pps00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100968756 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100968756 (MDM2)
   04151 PI3K-Akt signaling pathway
    100968756 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100968756 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    100968756 (MDM2)
   04115 p53 signaling pathway
    100968756 (MDM2)
   04218 Cellular senescence
    100968756 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100968756 (MDM2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100968756 (MDM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100968756 (MDM2)
   05202 Transcriptional misregulation in cancer
    100968756 (MDM2)
   05206 MicroRNAs in cancer
    100968756 (MDM2)
   05205 Proteoglycans in cancer
    100968756 (MDM2)
   05203 Viral carcinogenesis
    100968756 (MDM2)
  09162 Cancer: specific types
   05214 Glioma
    100968756 (MDM2)
   05220 Chronic myeloid leukemia
    100968756 (MDM2)
   05218 Melanoma
    100968756 (MDM2)
   05219 Bladder cancer
    100968756 (MDM2)
   05215 Prostate cancer
    100968756 (MDM2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100968756 (MDM2)
   05169 Epstein-Barr virus infection
    100968756 (MDM2)
   05165 Human papillomavirus infection
    100968756 (MDM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100968756 (MDM2)
   01522 Endocrine resistance
    100968756 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100968756 (MDM2)
   04121 Ubiquitin system [BR:pps04121]
    100968756 (MDM2)
Enzymes [BR:pps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100968756 (MDM2)
Membrane trafficking [BR:pps04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    100968756 (MDM2)
Ubiquitin system [BR:pps04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    100968756 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 zf-FPG_IleRS
Other DBs
NCBI-GeneID: 100968756
NCBI-ProteinID: XP_003808765
UniProt: A0A2R9AQ86
Position
12
AA seq 497 aa
MVRSRQMCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVL
FYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQE
SSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDE
LSGERQRKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGD
WLDQDSVSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYRVTVYQAGESDTDSFEED
PEISLADYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAE
EGFDVPDCKKTIVNDSRESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEF
EREETQDKEESMESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKP
CPVCRQPIQMIVLTYFP
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggtgaggagcaggcaaatgtgcaataccaacatgtctgtacctactgatggtgctgta
accacctcacagattccagcttcggaacaagagaccctggttagaccaaagccattgctt
ttgaagttattaaagtctgttggtgcacaaaaagacacttatactatgaaagaggttctt
ttttatcttggccagtatattatgactaaacgattatatgatgagaagcaacaacatatt
gtatattgttcaaatgatcttctaggagatttgtttggcgtgccaagcttctctgtgaaa
gagcacaggaaaatatataccatgatctacaggaacttggtagtagtcaatcagcaggaa
tcatcggactcaggtacatctgtgagtgagaacaggtgtcaccttgaaggtgggagtgat
caaaaggaccttgtacaagagcttcaggaagagaaaccttcatcttcacatttggtttct
agaccatctacctcatctagaaggagagcaattagtgagacagaagaaaattcagatgaa
ttatctggtgaacgacaaagaaaacgccacaaatctgatagtatttccctttcctttgat
gaaagcctggctctgtgtgtaataagggagatatgttgtgaaagaagcagtagcagtgaa
tctacagggacgccatcgaatccggatcttgatgctggtgtaagtgaacattcaggtgat
tggttggatcaggattcagtttcagatcagtttagtgtagaatttgaagttgaatctctc
gactcagaagattatagccttagtgaagaaggacaagaactctcagatgaagatgatgag
gtatatcgagttactgtgtatcaggcaggggagagtgatacagattcatttgaagaagat
cctgaaatttccttagctgactattggaaatgcacttcatgcaatgaaatgaatcccccc
cttccatcacattgcaacagatgttgggcccttcgtgagaattggcttcctgaagataaa
gggaaagataaaggggaaatctctgagaaagccaaactggaaaactcaacacaagctgaa
gagggctttgatgttcctgattgtaaaaaaactatagtgaatgattccagagagtcatgt
gttgaggaaaatgatgataaaattacacaagcttcacaatcacaagaaagtgaggactat
tctcagccatcaacttctagtagcattatttatagcagccaagaagatgtgaaagagttt
gaaagggaagaaacccaagacaaagaagagagtatggaatctagtttgccccttaatgcc
attgaaccttgtgtgatttgtcaaggtcgacctaaaaatggttgcattgtccatggcaaa
acaggacatcttatggcctgctttacatgtgcaaagaagctaaagaaaaggaataagccc
tgcccagtatgtagacaaccaattcaaatgattgtgctaacttatttcccctag

DBGET integrated database retrieval system