KEGG   Pan paniscus (bonobo): 100968765
Entry
100968765         CDS       T02283                                 

Gene name
SNX5
Definition
(RefSeq) sorting nexin 5
  KO
K17920  sorting nexin-5/6/32
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100968765 (SNX5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100968765 (SNX5)
Membrane trafficking [BR:pps04131]
 Endocytosis
  Macropinocytosis
   Sorting nexins
    100968765 (SNX5)
SSDB
Motif
Pfam: Vps5 PX BAR
Other DBs
NCBI-GeneID: 100968765
NCBI-ProteinID: XP_008961178
UniProt: A0A2R8ZIM8
Position
20
AA seq 404 aa
MAAVPELLQQQEEDRSKLRSVSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQS
PEFSVTRQHEDFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEE
FAKMKQELEAEYLAVFKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTK
EMFGGFFKSVVKSADEVLFTGVKEVDDFFEQEKNFLINYYNRIKDSCVKADKMTRSHKNV
ADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVEGRVSSDEDLKLTELLRYYML
NIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAEAHQQECCQKFEQLSESAKEE
LINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCIDLFKNN
NT seq 1215 nt   +upstreamnt  +downstreamnt
atggccgcggttcccgagttgctgcagcagcaggaggaggaccgcagcaagctgagatct
gtatctgtggacctgaatgttgatccctcgcttcagattgacatacctgatgcgctcagt
gagagagacaaagtcaaatttacagtgcacacaaagaccacactgcccacgtttcagagc
ccagagttttctgttacaaggcaacatgaagactttgtgtggctacatgacactcttatt
gaaacaacagactatgctgggcttattattccacctgctcctacgaagcccgactttgat
ggtcctcgagagaagatgcagaaactgggagaaggtgaagggtctatgaccaaagaagaa
tttgccaagatgaaacaagaactggaagctgagtatctcgctgtgtttaagaagactgtg
tcctcccatgaagtctttcttcagcggctttcttctcaccctgttctcagtaaagatcgc
aactttcatgttttcctggaatatgatcaggatctaagtgttaggcggaaaaatactaaa
gagatgtttggtggcttcttcaaaagtgtggtgaaaagtgctgatgaagtcctttttact
ggagttaaggaggtagatgacttctttgagcaagagaagaacttccttattaactattac
aataggatcaaagattcttgtgtgaaagctgacaaaatgaccagatctcataaaaatgtt
gccgatgactatatccacaccgcagcctgcttacatagcctggctttagaagagcccaca
gtcatcaaaaagtacctattgaaggttgctgagctatttgaaaaactaaggaaagtagag
ggtcgagtttcatcagatgaagatttgaagctaacagagctcctccgatactacatgctc
aacattgaagctgctaaggatctcttatacagacgcaccaaagccctcattgactatgag
aactcaaacaaagctctggataaggcccggttaaagagcaaagacgtcaagttggctgag
gcacaccagcaggagtgctgccagaaatttgaacaactttccgaatctgcaaaagaagaa
ctgataaatttcaaacggaagagagtggcagcatttagaaagaatctaattgaaatgtct
gaactggaaataaaacatgccaggaacaatgtctcccttttgcagagctgtattgacttg
ttcaagaataactga

DBGET integrated database retrieval system