KEGG   Pan paniscus (bonobo): 100968828
Entry
100968828         CDS       T02283                                 

Gene name
PTPRN
Definition
(RefSeq) protein tyrosine phosphatase, receptor type N
  KO
K07817  receptor-type tyrosine-protein phosphatase N [EC:3.1.3.48]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04940  Type I diabetes mellitus
Brite
KEGG Orthology (KO) [BR:pps00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100968828 (PTPRN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pps01009]
    100968828 (PTPRN)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100968828 (PTPRN)
Protein phosphatases and associated proteins [BR:pps01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    100968828 (PTPRN)
SSDB
Motif
Pfam: Y_phosphatase RESP18 Receptor_IA-2 DSPc
Other DBs
NCBI-GeneID: 100968828
NCBI-ProteinID: XP_003818701
Position
2B
AA seq 979 aa
MRRPRRPGGLGGSGGLRLLLCLLLLSSRPGGCSAVSAHGCLFDRRLCSHLEVCIQDGLFG
QCQVGVGQARPLLQVTSPVLQRLQGVLRQLMSQGLSWHDDLTQYVISQEMERIPRLRPPE
PHPRDRSGLAPKRPGPAGELLLQDIPTGSAPAAQHRLPQPPVGKGGAGASSSLSPLQAEL
LPPLLEHLLLPPQPPHPSLSYEPALLQPYLFHQFGSRDGSRVSEGSPGMVSVGPLPKAEA
PALFSRTASKGIFGDHPGHSYGDLPGPSPAQLFQDSGLLYLAQELPAPSRARVPRLPEQG
GSSRAEDSPEGYEKEGLGDRGEKPASPAVQPDAALQRLAAVLAVYGVELRQLTPEQLSTL
LTLLQLLPKGAGRNPGGVVNVGADIKKTMEGPVEGRDTAELPARTPPMPGHPTASPTSSE
VQQVPSPVSSEPPKAARPPATPVLLEKKSPLGQSQPTVAGQPSAHPAAEEYGYIVTDQKP
LSLAAGVKLLEILAEHVHMSSGSFINISVVGPALTFRIRHNEQNLSLADVTQQAGLVKSE
LEAQTGLQILQTGVGQREEAAAVLPRTAHSTSPMRSVLLTLVALAGVAGLLVALAVALCV
RQHARQRDKERLAALGPEGAHGDTTFEYQDLCRQHMATKSLFNRAEGPPEPSRVSSVSSQ
FSDAAQASPSSHSSTPSWCEEPAQANMDISTGHMILAYMEDHLRNRDRLAKEWQALCAYQ
AEPNTCATAQGEGNIKKNRHPDFLPYDHARIKLKVESSPSRSDYINASPIIEHDPRMPAY
IATQGPLSHTIADFWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPDEGASLYHVYEVNLV
SEHIWCEDFLVRSFYLKNVQTQETRTLTQFHFLSWPAEGTPASTRPPISCCRKVNKCYRG
RSCPIIVHCSDGAGRTGTYILIDMVLNRMAKGVKEIDIAATLEHVRDQRPGLVRSKDQFE
FALTAVAEEVNAILKALPQ
NT seq 2940 nt   +upstreamnt  +downstreamnt
atgcggcgcccgcggcggcctgggggtctcgggggatccgggggtctccggctgctcctc
tgcctcctgctgctgagcagccgcccggggggctgcagcgccgttagtgcccatggctgt
ctatttgaccgcaggctctgctctcacctggaagtctgtattcaggatggcttgtttggg
cagtgccaggtgggagtggggcaggcccggccccttttgcaagtcacctccccagttctc
caacgcttacaaggtgtgctccgacaactcatgtcccaaggattgtcctggcacgatgac
ctcacccagtatgtgatctctcaggagatggagcgcatccccaggcttcgccccccagag
ccccatccaagggacaggtctggcttggcacccaagagacctggtcctgctggagagctg
cttttacaggacatccccactggctccgcccctgctgcccagcatcggcttccacaacca
ccagtgggcaaaggtggagctggggccagctcctctctgtcccctctgcaggctgagctg
ctcccccctctcttggagcacctgctgctgcccccacagcctccccacccttcactgagt
tacgaacctgccttgctgcagccctacctgttccaccagtttggctcccgtgatggctcc
agggtctcagagggctccccagggatggtcagtgttggccccctgcccaaggctgaagcc
cctgccctcttcagcagaactgcctccaagggcatatttggggaccaccctggccactcc
tacggggaccttccagggccttcacctgcccagctttttcaggactctgggctgctctat
ctggcccaggagttgccagcacccagcagggccagggtgccaaggctgccagagcaaggg
ggcagcagccgggcagaggactccccagagggctatgagaaggaaggactaggggatcgt
ggagagaagcctgcttccccagctgtgcagccagatgcggctctgcagaggctggccgct
gtgctggcggtctatggggtagagctgcgtcagctgacccctgagcagctctccacactc
ctgaccctgctgcagctactgcccaagggtgcaggaagaaatccaggaggggttgtaaat
gttggagctgatatcaagaaaacaatggaggggccggtggagggcagagacacagcagag
cttccagcccgcacaccccccatgcctggacaccccactgccagccccacctccagtgaa
gtccagcaggtgccaagccctgtctcctctgagcctcccaaagctgccagaccccctgcg
acacctgtcctgctagagaagaaaagcccactgggccagagccagcccacggtggcagga
cagccctcagcccacccagcagcggaggaatatggctacatcgtcactgatcagaagccc
ctgagcctggctgcaggagtgaagctgctggagatcctggctgagcatgtgcacatgtcc
tcaggcagcttcatcaacatcagtgtggtgggaccagccctcaccttccgcatccggcac
aatgagcagaacctgtctttggctgatgtgacccaacaagcagggctggtgaagtctgaa
ctggaagcacagacagggctccaaatcttgcagacaggagtgggacagagggaggaggca
gctgcagtccttccccgaaccgcgcacagcacctctcccatgcgctcagtgctgctcact
ctggtggccctggcaggtgtggctgggctgctggtggctctggctgtggctctgtgtgtg
cggcagcatgcgcggcagcgagacaaggagcgcctggcagccctggggcctgagggggcc
catggtgacactacctttgagtaccaggacctgtgccgccagcacatggccacgaagtcc
ttgttcaaccgggcagagggtccgccggagccttcacgggtgagcagtgtgtcctcccag
ttcagtgacgcagctcaggccagccccagctcccacagcagcaccccgtcctggtgcgag
gagccggcccaagccaacatggacatctccacaggacacatgattctggcatacatggag
gatcacctgcggaaccgggaccgccttgccaaggagtggcaggccctctgtgcctaccaa
gcagagccaaacacctgtgccaccgcgcagggggagggcaacatcaaaaagaaccggcat
cctgacttcctgccctatgaccatgcccgcataaaactgaaggtggagagcagcccttct
cggagcgattacatcaatgccagccccattattgagcatgaccctcggatgccagcctac
atagccacgcagggcccgctgtcccataccatcgcagacttctggcagatggtgtgggag
agcggctgcaccgtcatcgtcatgctgaccccgctggtggaggatggtgtcaagcagtgt
gaccgctactggccagatgagggtgcctccctctaccacgtatatgaggtgaacctggtg
tcggagcacatctggtgcgaggactttctggtgcggagcttctacctgaagaacgtgcag
acccaggagacgcgcacgctcacgcagttccacttcctcagctggccggcagagggcaca
ccggcctccacgcggccacccatttcttgttgcaggaaggtgaacaagtgctaccggggc
cgctcctgccccatcatcgtgcactgcagtgacggtgcggggaggaccggcacctacatc
ctcatcgacatggtcctgaaccgcatggcaaaaggagtgaaggagattgacatcgctgcc
accctggagcatgtccgtgaccagcggcctggccttgtccgctctaaggaccagtttgaa
tttgccctgacagccgtggcggaggaagtgaatgccatcctcaaggccctgccccagtga

KEGG   Pan paniscus (bonobo): 100978473
Entry
100978473         CDS       T02283                                 

Gene name
PTPRN2
Definition
(RefSeq) protein tyrosine phosphatase, receptor type N2
  KO
K07817  receptor-type tyrosine-protein phosphatase N [EC:3.1.3.48]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04940  Type I diabetes mellitus
Brite
KEGG Orthology (KO) [BR:pps00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100978473 (PTPRN2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pps01009]
    100978473 (PTPRN2)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100978473 (PTPRN2)
Protein phosphatases and associated proteins [BR:pps01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    100978473 (PTPRN2)
SSDB
Motif
Pfam: Y_phosphatase Receptor_IA-2 RESP18 DSPc CD34_antigen
Other DBs
NCBI-GeneID: 100978473
NCBI-ProteinID: XP_008967651
Position
7
AA seq 977 aa
MECLEGARRFRQWTFTATRCRPWPCSACVWRCRSFPAQLHRRHNWETHQPIQLTGFTWQD
DYTQYVMDQELADLPKTYLRRPEASSPARLSKHSVGSERRYSREGGAALAKALRRHLPFL
EALSQAPASDVLARTHTAQDRPPAEGDDRFSESILTYVAHTSALTYPPGPRTQLREDLLP
RTLGQLQPDELSPKVDSGVDRHHLMAALGAYAAQRPPAPPGEGSLEPQYLLRAPSRMPRP
LLAPAAPQKWPSPLGDPEDPSSTGDGARIHTLLKDLQRQPAEVRGLSDLELDGMAELMAG
LMQGVDHGVARGSPGRAALGESGEQADGPKATLRGDSFPDDGVQDDDDRLYQEVHRLSAT
LGGLLQDHGSRLLPGALPFAKPLDMERKKSEHPEASLSSEEETAGVENVKSQTYSKDLLG
QQPHSEPGAVAFGELQNQMPGPSKEEQSLPAGAQEALGDGLQLEVKPSEEEARGYIVTDR
DPLRPEEGRRLVEDVARLLQVPSSAFTDVEVLGPAVTFKVSANVQNVTTEDVEKATVDNK
DKLEETSGLKILQTGVGSKSKLKFLPPQAEQEDSTKFIALTLVSLACILGVLLASGLIYC
LRHSSQHRLKEKLSGLGGDPGADATAAYQELCRQRMATRPPDRPEGPHTSRISSVSSQFS
DGPIPSPSARSSASSWSEEPVQSNMDISTGHMILSYMEDHLKNKNRLEKEWEALCAYQAE
PNSSFVAQREENVPKNRSLAVLTYDHSRVLLKAENSHSHSDYINASPIMDHDPRNPTYIA
TQGPLPATVADFWQMVWESGCVVIVMLTPLAENGVRQCYHYWPDEGSNLYHIYEVNLVSE
HIWCEDFLVRSFYLKNLQTNETRTVTQFHFLSWYDRGVPSSSRSLLDFRRKVNKCYRGRS
CPIIVHCSDGAGRSGTYVLIDMVLNKMAKGAKEIDIAATLEHLRDQRPGMVQTKEQFEFA
LTAVAEEVNAILKALPQ
NT seq 2934 nt   +upstreamnt  +downstreamnt
atggagtgtttggaaggtgccagaaggttccggcaatggacttttaccgctacgaggtgt
cgcccgtggccctgcagcgcctgcgtgtggcgttgcagaagctttccggcacagctgcat
agacgtcacaactgggagactcatcagccaatccaactcacaggtttcacgtggcaggat
gactatactcagtatgtgatggaccaggaacttgcagacctcccgaaaacctacctgagg
cgtcctgaagcatccagcccagccaggctctcaaaacacagcgttggcagcgagaggagg
tacagtcgggagggcggcgctgccctggccaaggccctccgacgccacctgcccttcctg
gaggccctgtcccaggccccagcctcagatgtgctcgccaggacccatacagcgcaggac
agaccccccgctgagggtgacgaccgcttctccgagagcatcctgacctatgtggcccac
acgtctgcgctgacctaccctcccgggccccggacccagctccgcgaggacctcctgcca
cggaccctcggccagctccagccagacgagctcagccctaaggtggacagtggtgtggac
agacaccatctgatggcggccctcggtgcctatgctgcccagaggcccccagctcccccc
ggggagggcagcctggagccacagtaccttctgcgtgcaccctcaagaatgcccaggccc
ttgctggcaccagccgcaccccagaagtggccttcacctctgggagatcccgaagacccc
tccagcacaggcgatggagcacggattcacaccctcctgaaggacctgcagaggcagccg
gctgaggtgaggggcctgagtgacctggagctggacggcatggccgagctgatggctggc
ctgatgcaaggcgtggaccatggagtagctcgaggcagccctgggagagcggccctggga
gagtctggagaacaggcggatggccccaaggccaccctccgtggagacagctttccagat
gacggagtgcaggacgacgatgatagactttaccaagaggtccatcgtctgagtgccaca
ctcgggggcctcctgcaggaccacgggtctcgactcttacctggagccctcccctttgca
aagcccctcgacatggagaggaagaaatccgagcaccctgaggcttccctgtcttcagaa
gaggagactgccggagtggagaacgtcaagagccagacgtattccaaagatctgctgggg
cagcagccgcattcggagcccggggccgttgcgtttggggagctccaaaaccagatgcct
gggccctcgaaggaggagcagagccttccagcgggtgctcaggaggccctcggcgacggc
ctgcaattggaggtcaagccttccgaggaagaggcgcggggctacatcgtgacagacaga
gaccccctgcgccccgaggaaggaaggcggctggtggaggacgtcgcccgcctcctgcag
gtgcccagcagcgcgttcaccgacgtggaggttctcggaccagcagtgaccttcaaagtg
agcgccaatgtccaaaacgtgaccactgaggatgtggagaaggccacagttgacaacaaa
gacaaactggaggaaacctctggactgaaaattcttcaaaccggagtcgggtcgaaaagc
aaactcaagttcctgcctcctcaggcggagcaagaagactccaccaagttcatcgcgctc
accctggtctccctcgcctgcatcctgggcgtcctcctggcctctggcctcatctactgc
ctccgccatagctctcagcacaggctgaaggagaagctctcgggactagggggtgaccca
ggtgcagatgccactgccgcctaccaggagctgtgccgccagcgtatggccacgcggcca
ccagaccgacccgagggcccacacacgtcacgcatcagcagcgtctcatcccagttcagc
gacgggccgatccccagcccctccgcgcgcagcagcgcctcatcctggtccgaggagccc
gtgcagtccaacatggacatctccaccggccacatgatcctgtcctacatggaggaccac
ctgaagaacaagaaccggctggagaaggagtgggaagcgctgtgcgcctaccaggcggag
cccaacagctcgttcgtggcccagagggaggagaacgtgcccaagaaccgctccctggct
gtgctgacctatgaccactcccgggtcctgctgaaggcggagaacagccacagccactca
gactacatcaacgccagccccatcatggatcacgacccgaggaaccccacgtacatcgcc
acccagggaccgctgcccgccactgtggctgacttttggcagatggtgtgggagagcggc
tgcgtggtgatcgtcatgctgacacccctcgcggagaacggtgtccggcagtgctaccac
tactggccggatgaaggctccaatctctaccacatctatgaggtgaacctggtctccgag
cacatctggtgtgaggacttcctggtgaggagcttctatctgaagaacctgcagaccaac
gagacgcgcaccgtgactcagttccacttcctgagttggtatgaccgaggagtcccttcc
tcctcaaggtccctcctggacttccgcagaaaagtaaacaagtgctacaggggccgttct
tgtccaataattgttcattgcagtgacggtgcaggccggagcggcacctacgtcctgatc
gacatggttctcaacaagatggccaaaggtgctaaagagattgatatcgcagcgaccctg
gagcacttgagggaccagagacccggcatggtccagacgaaggagcagtttgagtttgcg
ctgacagccgtggccgaggaggtgaacgccatcctcaaggcccttccccagtga

DBGET integrated database retrieval system