KEGG   Pan paniscus (bonobo): 100968890Help
Entry
100968890         CDS       T02283                                 

Gene name
MTMR10
Definition
(RefSeq) myotubularin related protein 10
  KO
K18085  myotubularin-related protein 10/11/12
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pps01009]
    100968890 (MTMR10)
Protein phosphatases and associated proteins [BR:pps01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    100968890 (MTMR10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related 3-PAP
Motif
Other DBs
NCBI-GeneID: 100968890
NCBI-ProteinID: XP_003809614
UniProt: A0A2R9A333
Position
15
AA seq 779 aa AA seqDB search
MFSLKPPKPTFRSYLLPPPQTDDKINSEPKIKKLEPVLLPGEIVVNEVNFVRKCIATDTS
QYDLWGKLICSNFKISFITDDPMPLQKFHYRNLLLGEHDVPLTCIEQIVTVNDHKRKQKV
LGPNQKLKFNPTELIIYCKDFRIVRFRFDESGPESAKKVCLAIAHYSQPTDLQLLFAFEY
VGKKYHNSANKINGIPSGDGGGGGGGGGGNGAGGGSSQKTPLFETYSDWDREIKRTGASG
WRVCSINEGYMISTCLPEYIVVPSSLADQDLKIFSHSFVGRRMPLWCWSHSNGSALVRMA
LIKDVLQQRKIDQRICNAITKSHPQRSDVYKSDLDKTLPNIQEVQAAFVKLKQLCVNEPF
EETEEKWLSSLENTRWLEYVRAFLKHSAELVYMLESKHLSVVLQEEEGRDLSCCVASLVQ
VMLDPYFRTITGFQSLIQKEWVMAGYQFLDRCNHLKRSEKESPLFLLFLDATWQLLEQYP
AAFEFSETYLAVLYDSTRISLFGTFLFNSPHQRVKQSTEFAISKNIQLGDEKGLKFPSVW
DWSLQFTAKDRTLFHNPFYIGKSTPCIQNGSVKSFKRTKKSYSSTLRGMPSALKNGIISD
QELLPRRNSLILKPKPDPAQQTDSQNSDTEQYFREWFSKPANLHGVILPRVSGTHIKLWK
LCYFRWVPEAQISLGGSITAFHKLSLLADEVDVLSRMLRQQRSGPLEACYGELGQSRMYF
NASGPHHTDTSRTPEFLSSSFPFSPVGNLCRRSILGTPLSKFLSGAKIWLSTETLANED
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atgttctctctcaagccgcccaaacccaccttcaggtcctacctcctgccaccgccccag
actgacgataagatcaattcggaaccgaagattaaaaaactggagccagtccttttgcca
ggagaaattgtcgtaaatgaagtcaattttgtgagaaaatgcattgcaacagacacaagc
cagtacgatttgtggggaaagctgatatgcagtaacttcaaaatctcctttattacagat
gacccaatgccattacagaaattccattacagaaaccttcttcttggtgaacacgatgtc
cctttaacatgtattgagcaaattgtcacagtaaatgaccacaagaggaagcagaaagtc
ctaggccccaaccagaaactgaaatttaatccaacagagttaattatttattgtaaagat
ttcagaattgtcagatttcgctttgatgaatcaggtcccgaaagtgctaaaaaggtatgc
cttgcaatagctcattattcccagccaacagacctccagctactctttgcatttgaatat
gttgggaaaaaataccacaattcagcaaacaaaattaatggaattccctcaggagatgga
ggaggaggaggaggaggaggaggaggtaatggagctggtggtggcagcagccagaaaact
ccactctttgaaacttactcggattgggacagagaaatcaagaggacaggtgcttccggg
tggagagtttgttctattaacgagggttacatgatatccacttgccttccagaatacatt
gtagtgccaagttctttagcagaccaagatctaaagatcttttcccattcttttgttggg
agaaggatgccactctggtgctggagccactctaacggcagtgctcttgtgcgaatggcc
ctcatcaaagacgtgctgcagcagaggaagattgaccagaggatttgtaatgcaataact
aaaagtcacccacagagaagtgatgtttacaaatcagatttggataagaccttgcctaat
attcaagaagtacaggcagcatttgtaaaactgaagcagctatgcgttaatgagcctttt
gaagaaactgaagagaaatggttatcttcactggaaaatactcgatggttagaatatgta
agggcattccttaagcattcagcagaacttgtatacatgctagaaagcaaacatctctct
gtagtcctacaagaggaggaaggaagagacttgagctgttgtgtagcttctcttgttcaa
gtgatgctggatccctattttaggacaattactggatttcagagtctgatacagaaggag
tgggtcatggcaggatatcagtttctagacagatgcaaccatctaaagagatcagagaaa
gagtctcctttatttttgctattcttggatgccacctggcagctgttagaacaatatcct
gcagcttttgagttctccgaaacctacctggcagtgttgtatgacagcacccggatctca
ctgtttggcaccttcctgttcaactcccctcaccagcgagtgaagcaaagcacggaattt
gctataagcaaaaatatccaattgggtgatgagaagggcttaaaattcccctctgtttgg
gactggtctctccagtttacagcaaaggatcgcacccttttccataaccccttctacatt
ggaaagagcacaccttgtatacagaatggctccgtgaagtcttttaaacggacaaagaaa
agctacagctccacactaagaggaatgccgtctgccttaaagaatggaatcatcagtgac
caagaattacttccaaggagaaattcattgatattaaaaccaaaaccagatccagctcag
caaaccgacagccagaacagtgatacggagcagtattttagagaatggttttccaaaccc
gccaacctgcacggtgttattctgccacgtgtttctggaacacacataaaactgtggaaa
ctgtgctacttccgctgggttcctgaggcccagatcagcctgggtggctccatcacagcc
tttcacaagctctccctcctggctgatgaagtcgacgtgctgagcaggatgctgcggcaa
cagcgcagtggccccctggaggcctgctatggggagctgggccagagcaggatgtacttc
aacgccagcggccctcaccacaccgacacctcgaggacaccggagtttctctcctcctca
tttccattttctcctgtagggaatctgtgcagacgaagcattttaggaacaccattaagc
aaatttttaagtggggccaaaatatggttgtctactgagacattagcaaatgaagactaa

DBGET integrated database retrieval system