KEGG   Pan paniscus (bonobo): 100969017Help
Entry
100969017         CDS       T02283                                 

Gene name
CPT1A
Definition
(RefSeq) carnitine palmitoyltransferase 1A
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00071  Fatty acid degradation
pps01212  Fatty acid metabolism
pps03320  PPAR signaling pathway
pps04152  AMPK signaling pathway
pps04714  Thermogenesis
pps04920  Adipocytokine signaling pathway
pps04922  Glucagon signaling pathway
pps04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100969017 (CPT1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100969017 (CPT1A)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100969017 (CPT1A)
   04920 Adipocytokine signaling pathway
    100969017 (CPT1A)
   03320 PPAR signaling pathway
    100969017 (CPT1A)
  09159 Environmental adaptation
   04714 Thermogenesis
    100969017 (CPT1A)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100969017 (CPT1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pps03029]
    100969017 (CPT1A)
Enzymes [BR:pps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     100969017 (CPT1A)
Mitochondrial biogenesis [BR:pps03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100969017 (CPT1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 100969017
NCBI-ProteinID: XP_008952449
UniProt: A0A2R8ZQ50
Position
11
AA seq 773 aa AA seqDB search
MAEAHQAVAFQFTVTPDGIDLRLSHEALRQIYLSGLHSWKKKFIRFKNGIITGVYPASPS
SWLIVVVGVMTTMYAKIDPSLGIIAKINRTLETANCMSSQTKNVVSGVLFGTGLWVALIV
TMRYSLKVLLSYHGWMFTEHGKMSRATKIWMGMVKIFSGRKPMLYSFQTSLPRLPVPAVK
DTVNRYLQSVRPLMKEEDFKRMTALAQDFAVGLGPRLQWYLKLKSWWATNYVSDWWEEYI
YLRGRGPLMVNSNYYAMDLLYILPTHIQAARAGNAIHAILLYRRKLDREEIKPIRLLGST
IPLCSAQWERMFNTSRIPGEETDTIQHMRDSKHIVVYHRGRYFKVWLYHDGRLLKPREME
QQMQRILDNTSEPQPGEARLAALTAGDRVPWARCRQAYFGRGKNKQSLDAVEKAAFFVTL
DETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPI
VAHLWEYVMSTDSLQLGYAEDGHCKGDTNPNIPYPTRLQWDIPGECQEVIETSLNTANLL
ANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREG
RTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCL
YVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGY
GVSYILVGENLINFHISSKFSCPETDSHRFGRHLKEAMTDIITLFGLSSNSKK
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagctcaccaagctgtggcttttcagttcacggtcactccggacgggattgac
ctgcggctgagccatgaagctcttagacaaatctatctctctggacttcattcctggaaa
aagaagttcatcagattcaagaacggcatcatcactggcgtgtacccggcaagcccctcc
agttggcttatcgtggtggtgggtgtgatgacaacgatgtacgccaagatcgacccctcg
ttaggaataattgcaaaaatcaatcggaccctggaaacggccaactgcatgtccagccag
acgaagaacgtggtcagcggcgtgctgtttggcaccggcctgtgggtggccctcatcgtc
accatgcgctactccctgaaagtgctgctctcctaccacgggtggatgttcactgagcac
ggcaagatgagtcgtgccaccaagatctggatgggtatggtcaagatcttttcaggccga
aaacccatgttgtacagcttccagacatcgctgcctcgcctgccggtcccggctgtcaaa
gacactgtgaacaggtatctacagtcggtgaggcctcttatgaaggaagaagacttcaaa
cggatgacagcacttgctcaagattttgctgtcggtcttggaccaagattacagtggtat
ttgaagttaaaatcctggtgggctacaaattacgtgagcgactggtgggaggagtacatc
tacctccgaggacgagggccgctcatggtgaacagcaactattatgccatggatctgctg
tatatacttccaactcacattcaggcagcaagagccggcaacgccatccatgccatcctg
ctttacaggcgcaaactggaccgggaggaaatcaaaccaattcgtcttttgggatccacg
attccactctgctccgctcagtgggagcggatgtttaatacttcccggatcccaggagag
gagacagacaccatccagcacatgagagacagcaagcacatcgtcgtgtaccatcgagga
cgctacttcaaggtctggctctaccatgacgggcggctgctgaagccccgggagatggag
cagcagatgcagaggatcctggacaatacctcggagcctcagcccggggaggccaggctg
gcagccctcactgcaggagacagagttccctgggccaggtgtcgtcaggcctattttgga
cgtgggaaaaataagcagtctcttgatgctgtggagaaagcagcattcttcgtgacgtta
gatgaaactgaagaaggatacagaagtgaagacccagatacgtcgatggacagctacgcc
aaatctctactacacggccgatgttacgacaggtggtttgacaagtcgttcacgtttgtt
gtcttcaaaaacgggaagatgggcctcaacgccgaacactcctgggcagatgcgccgatc
gtggcccacctttgggagtacgtcatgtccactgacagcctccagctgggctatgcggag
gatgggcactgcaaaggcgacaccaatccgaacattccgtaccccaccaggctgcagtgg
gacatcccgggggaatgtcaagaggttatagagacctccctgaacaccgcaaatcttctg
gcaaacgacgtggatttccattccttcccattcgtagcctttggtaaaggaatcatcaag
aaatgtcgcacgagcccagacgcctttgtgcagctggccctccagctggcgcactacaag
gacatgggcaagttttgcctcacatacgaggcctccatgacccggctcttccgagagggg
aggacggagaccgtgcgctcctgcaccactgagtcatgcgacttcgtgcgggccatggtg
gacccggcccagacggtggaacagaggctgaagttgttcaagttggcgtctgagaagcat
cagcatatgtatcgcctcgccatgaccggctctgggatcgatcgtcacctcttctgcctt
tacgtggtgtctaaatatctcgccgtggagtcccctttccttaaggaagttttatctgag
ccttggagattatcaacaagccagacccctcagcagcaagtggagctgtttgacttggag
aataacccagagtacgtgtccagcggagggggctttggaccggttgctgatgacggctat
ggtgtgtcgtacatccttgtgggagagaacctcatcaatttccacatttcttccaagttc
tcttgccctgagacggattctcatcgctttggaaggcacctgaaagaagcaatgactgac
atcatcactttgtttggtctcagttctaattccaaaaagtaa

DBGET integrated database retrieval system