KEGG   Pan paniscus (bonobo): 100969081
Entry
100969081         CDS       T02283                                 

Gene name
PIAS3
Definition
(RefSeq) protein inhibitor of activated STAT 3
  KO
K16064  E3 SUMO-protein ligase PIAS3 [EC:2.3.2.-]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04120  Ubiquitin mediated proteolysis
pps04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pps00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100969081 (PIAS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100969081 (PIAS3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pps04121]
    100969081 (PIAS3)
Enzymes [BR:pps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     100969081 (PIAS3)
Ubiquitin system [BR:pps04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   100969081 (PIAS3)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse
Other DBs
NCBI-GeneID: 100969081
NCBI-ProteinID: XP_003806249
UniProt: A0A2R9AN48
Position
1
AA seq 628 aa
MAELGELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKEL
YRRRFPRKTLGPSDLSLLSLPPGTSPVGSPGPLAPIPPTLLAPGTLLGPKREVDMHPPLP
QPVHPDVTMKPLPFYEVYGELIRPTTLASTSSQRFEEAHFTFALTPQQVQQILTSREVLP
GAKCDYTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGYLPPTKNGAEPKRPSR
PINITPLARLSATVPNTIVVNWSSEFGRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHS
RALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEK
KPTWTCPVCDKKAPYESLIIDGLFMEILSSCSDCDEIQFMEDGSWCPMKPKKEASEVCPP
PGYGLDGLQYSPVQGGNPSENKKKVEVIDLTIESSSDEEDLPPTKKHCSVTSAAIPALPG
SKGVLTSGHQPSSVLRSPAMGTLGGDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQ
HYGPSVITSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSIVAPG
GALREGHGGPLPSGPSLTGCRSDIISLD
NT seq 1887 nt   +upstreamnt  +downstreamnt
atggcggagctcggcgaattaaagcacatggtgatgagtttccgggtgtctgagctccag
gtgcttcttggctttgctggccggaacaagagtggacggaagcacgagctcctggccaag
gctctgcacctcttgaagtccagctgtgcccctagtgtccagatgaagatcaaagagctt
taccgacgacgctttccccggaagaccctggggccctctgatctctcccttctctctttg
ccccctggcacctctcctgtaggctcccctggtcctctagctcccattcccccaaccctg
ttggcccctggcaccctgctgggccccaagcgtgaggtggacatgcacccccctctgccc
cagcctgtgcaccctgatgtcaccatgaaaccattgcccttctatgaagtctatggggag
ctcatccggcccaccacccttgcatccacttctagccagcggtttgaggaagcgcacttt
acctttgccctcacaccccagcaagtgcagcagattcttacatccagagaggttctgcca
ggagccaaatgtgattataccatacaggtgcagctaaggttctgtctctgtgagaccagc
tgcccccaggaagattattttccccccaacctctttgtcaaggtcaatgggaaactgtgc
cccctgccgggttaccttcccccaaccaagaatggtgccgagcccaagaggcccagccgc
cccatcaacatcacacccctggctcgactctcagccactgttcccaacaccattgtggtc
aattggtcatctgagttcggacggaattactccttgtctgtgtacctggtgaggcagttg
actgcaggaacccttctacaaaaactcagagcaaagggtatccggaacccagaccactcg
cgggcactgatcaaggagaaattgactgctgaccctgacagtgaggtggccactacaagt
ctccgggtgtcactcatgtgcccgctagggaagatgcgcctgactgtcccttgtcgtgcc
ctcacctgcgcccacctgcagagcttcgatgctgccctttatctacagatgaatgagaag
aagcctacatggacatgtcctgtgtgtgacaagaaggctccctatgaatctcttatcatt
gatggtttatttatggagattcttagttcctgttcagattgtgatgagatccaattcatg
gaagatggatcctggtgcccaatgaaacccaagaaggaggcatctgaggtttgccccccg
ccagggtatgggctggatggcctccagtacagcccagtccaggggggaaatccatcagag
aataagaagaaggtcgaagttattgacttgacaatagaaagctcatcagatgaggaggat
ctgcctcctaccaagaagcactgttctgtcacctcagctgccatcccggccctacctgga
agcaaaggagtcctgacatctggccaccagccatcctcggtgctaaggagccctgctatg
ggcacgttgggtggggatttcctgtccagtctcccactacatgagtacccacctgccttc
ccactgggagccgacatccaaggtttagatttattttcatttcttcagacagagagtcag
cactatggcccctctgtcatcacctcactagatgaacaggatgcccttggccacttcttc
cagtaccgagggaccccttctcactttctgggcccactggcccccacgctggggagctcc
cactgcagcgccactccggcgccccctcctggccgtgtcagcagcattgtggcccctggg
ggggccttgagggaggggcatggaggacccctgccctcaggtccctctttgactggctgt
cggtcagacatcatttccctggactga

KEGG   Pan paniscus (bonobo): 100994639
Entry
100994639         CDS       T02283                                 

Gene name
PIAS4
Definition
(RefSeq) protein inhibitor of activated STAT 4
  KO
K16065  E3 SUMO-protein ligase PIAS4 [EC:2.3.2.27]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04064  NF-kappa B signaling pathway
pps04120  Ubiquitin mediated proteolysis
pps04630  JAK-STAT signaling pathway
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100994639 (PIAS4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100994639 (PIAS4)
   04064 NF-kappa B signaling pathway
    100994639 (PIAS4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100994639 (PIAS4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pps04121]
    100994639 (PIAS4)
Enzymes [BR:pps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100994639 (PIAS4)
Ubiquitin system [BR:pps04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   100994639 (PIAS4)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse CENP-B_dimeris SAP
Other DBs
NCBI-GeneID: 100994639
NCBI-ProteinID: XP_003819318
Position
19
AA seq 530 aa
MTSSLPAKALGRFQKKHLVRNPFCFLHKNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTR
ALQLVQFDCSPELFKKIKELYETRYAKKNSEPAPQPHRPLDPLTMHSTYDRAGAVPRTPL
AGPNIDYPVLYGKYLNGLGRLPAKTLKPEVRLVKLPFFNMLDELLKPTELVPQNNEKLQE
SPCIFALTPRQVELIRNSRELQPGVKAVQVVLRICYSDTSCPQEDQYPPNIAVKVNHSYC
SVPGYYPSNKPGVEPKRPCRPINLTHLMYLSSATNRITVTWGNYGKSYSVALYLVRQLTS
SELLQRLKTIGVKHPELCKALVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAET
CAHLQCFDAVFYLQMNEKKPTWMCPVCDKPAPYDQLIIDGLLSKILSECEDADEIEYLVD
GSWCPIRAEKERSCSPQGAILVLGPSDANGLLPAPSVNGSGALGSTGGGGPVGSVENGKP
GADVVDLTLDSSSSSEEEEEEEEEEEEDEDEEGPRPXRRCPFQKGLVPAC
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgacatcgtctctccctgctaaggctttgggccgcttccagaagaaacatcttgtccgc
aaccctttttgttttctgcacaagaacatggtgatgagttttcgagtgtccgaccttcag
atgctcctgggttttgtgggccggagtaagagtggactgaagcacgagctcgtcaccagg
gccctccagctggtgcagtttgactgtagccctgagctgttcaagaagatcaaggagctg
tacgagacccgctacgccaagaagaactcggagcctgccccacagccgcaccggcccctg
gaccccctgaccatgcactccacctacgaccgggccggcgctgtgcccaggactccgctg
gcaggccccaatattgactaccccgtgctctacggaaagtacttaaacggactgggacgg
ttgcccgccaagaccctcaagccagaagtccgcctggtgaagctgccgttctttaatatg
ctggacgagctgctgaagcccaccgaattagtcccacagaacaacgagaagcttcaggag
agcccgtgcatcttcgcattgacgccaagacaggtggagttgatccggaactccagggaa
ctgcagcccggagttaaagccgtgcaggtcgtcctgagaatctgttactcagacaccagc
tgccctcaggaggaccagtacccgcccaacatcgctgtgaaggtcaaccacagctactgc
tcggtcccgggctactacccctccaataagcccggggtggagcccaagaggccgtgccgc
cccatcaacctcacccacctcatgtacctgtcctcggccaccaaccgcatcaccgtcacc
tgggggaactacggcaagagctactcggtggccctgtacctggtgcggcagctgacctca
tcggagctgctgcagaggctgaagaccattggggtaaagcacccggagctgtgcaaggca
ctggtcaaggagaagctgcgccttgatcctgacagcgagatcgccaccaccggtgtgcgg
gtgtccctcatctgtccgctggtgaagatgcggctctccgtgccctgccgggcagagacc
tgcgcccacctgcagtgcttcgacgccgtcttctacctgcagatgaacgagaagaagccc
acctggatgtgccccgtgtgcgacaagccagccccctacgaccagctcatcatcgacggg
ctcctctcgaagattctgagcgagtgtgaggacgccgacgagatcgagtacctggtggac
ggctcgtggtgcccgatccgcgccgaaaaggagcgcagctgcagcccgcagggcgccatc
ctcgtgctgggcccctcggacgccaatgggctcctgcccgcccccagcgtcaacgggagc
ggtgccctgggcagcacgggtggcggcggcccggtgggcagcgtggagaatgggaagccg
ggcgccgatgtggtggacctcacgctggacagctcatcgtcctcggaggaggaggaggag
gaggaggaagaggaggaggaagacgaggacgaagaggggccccggccanagcgccgctgc
cccttccagaagggcctggtgccggcctgctga

KEGG   Pan paniscus (bonobo): 100995155
Entry
100995155         CDS       T02283                                 

Gene name
PIAS2
Definition
(RefSeq) protein inhibitor of activated STAT 2
  KO
K16063  E3 SUMO-protein ligase PIAS2 [EC:2.3.2.-]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04120  Ubiquitin mediated proteolysis
pps04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pps00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100995155 (PIAS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100995155 (PIAS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pps04121]
    100995155 (PIAS2)
Enzymes [BR:pps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     100995155 (PIAS2)
Ubiquitin system [BR:pps04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   100995155 (PIAS2)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse PHD
Other DBs
NCBI-GeneID: 100995155
NCBI-ProteinID: XP_008953866
Position
18
AA seq 619 aa
MLPFSQNMVSSFRVSELQVLLGFAGRNKSGRKHDLLMRALHLLKSGCSPAVQIKIRELYR
RRYPRTLEGLSDLSTIKSSVFSLDGGSSPVEPDLAVAGIHSLPSTSVTPHSPSSPVGSVL
LQDTKPTFEMQQPSPPIPPVHPDVQLKNLPFYDVLDVLIKPTSLVQSSIQRFQEKFFIFA
LTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQEDNYPNSLCIKVNGKLFPLP
GYAPPPKNGIEQKRPGRPLNITSLVRLSSAVPNQISISWASEIGKNYSMSVYLVRQLTSA
MLLQRLKMKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLMCPLGKMRLTIPCRAVTC
THLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDCSDVDEIKFQEDG
SWCPMRPKKEAMKVSSQPCTKIESSSVLSKPCSVTVASEASKKKVDVIDLTIESSSDEEE
DPPAKRKCIFMSETQSSPTKGVLMYQPSSVRVPSVTSVDPAAIPPSLTDYSVPFHHTPIS
SMSSDLPGLDFLSLIPVDPQYCPPMFLDSLTSPLTASSTSVTTTSSHESSTHVSSSSSRS
ETGVITSSGSNIPDIISLD
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgctaccgtttagtcagaatatggtttctagttttagggtttctgaactacaagtatta
ctaggctttgctggacggaataaaagtggacgcaagcatgacctcctgatgagggcgctg
catttattgaagagcggctgcagccctgcggttcagattaaaatccgagaattgtataga
cgccgatatccacgaactcttgaaggactttctgatttatccacaatcaaatcatcagtt
ttcagtttggatggtggctcatcacctgtagaacctgacttggccgtggctggaatccac
tcgttgccttccacttcagttacacctcactcaccatcctctcctgttggttctgtgctg
cttcaagatactaagcccacatttgagatgcagcagccatctcccccaattcctcctgtc
catcctgatgtgcagttaaaaaatctgcccttttatgatgtccttgatgttctcatcaag
cccacgagtttagttcaaagcagtattcagcgatttcaagagaagttttttatttttgct
ttgacacctcaacaagttagagagatatgcatatccagggattttttgccaggtggtagg
agagattatacagtccaagttcagttgagactttgcctggcagagacaagttgccctcaa
gaagataactatccaaatagtctatgtataaaagtaaatgggaagctatttcctttgcct
ggctatgcaccaccgcctaaaaatgggattgaacagaagcgccctggacgccccttgaat
attacatctttagttaggttatcttcagctgtgccaaaccaaatttccatttcttgggca
tcagaaattgggaagaattactctatgtctgtatatcttgtacggcagcttacatcagcc
atgttattacagagattaaaaatgaaaggtattagaaaccctgatcattccagagcacta
attaaagaaaaacttactgcagatcctgatagtgaaattgctacaactagccttcgggta
tccttgatgtgccctttaggaaaaatgaggctgacaatcccatgccgtgcagtgacttgt
acacatctgcagtgttttgatgctgccctttatctacaaatgaatgagaagaagcccacc
tggatttgtcctgtgtgtgacaaaaaagctgcctatgaaagcctaatattagatgggctt
tttatggaaattctcaatgactgttctgatgtagatgagatcaaattccaagaagatggt
tcttggtgtccaatgagaccgaagaaagaagctatgaaagtatccagccaaccgtgtaca
aaaatagaaagttcaagcgtcctcagtaagccttgttcagtgactgtagccagtgaggca
agcaagaagaaagtagatgttattgatcttacaatagaaagttcttctgacgaagaggaa
gaccctcctgccaaaaggaaatgcatctttatgtcagaaacacaaagcagcccaaccaaa
ggggttctcatgtatcagccatcttctgtaagggtgcccagtgtgacttcggttgatcct
gctgctattccgccttcattaacagactactcagtaccattccaccatacgccaatatca
agcatgtcatcagatttgccaggtttggattttctttcccttattccagttgatccccag
tactgtcctcctatgtttttggatagtctcacctcacccttaacagcaagcagtacgtct
gtcaccaccaccagctcccatgaaagcagtactcatgttagttcatccagcagcaggagt
gagacaggggtcataaccagcagtggaagtaacattcctgacatcatctcattggactaa

KEGG   Pan paniscus (bonobo): 100995827
Entry
100995827         CDS       T02283                                 

Gene name
PIAS1
Definition
(RefSeq) protein inhibitor of activated STAT 1
  KO
K04706  E3 SUMO-protein ligase PIAS1 [EC:2.3.2.-]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04120  Ubiquitin mediated proteolysis
pps04630  JAK-STAT signaling pathway
pps05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:pps00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100995827 (PIAS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100995827 (PIAS1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100995827 (PIAS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pps04121]
    100995827 (PIAS1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pps04812]
    100995827 (PIAS1)
Enzymes [BR:pps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     100995827 (PIAS1)
Ubiquitin system [BR:pps04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   100995827 (PIAS1)
Cytoskeleton proteins [BR:pps04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    100995827 (PIAS1)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse
Other DBs
NCBI-GeneID: 100995827
NCBI-ProteinID: XP_003828059
UniProt: A0A2R9C8W8
Position
15
AA seq 653 aa
MFTLQDSYIKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIK
ELYRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKH
ELELPHLTSALHPVHPDIKLQKLPFYDLLDELIKPTSLASDNSQRFRETCFAFALTPQQV
QQISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTK
NGVEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNYSMAVYLVKQLSSTVLLQRLR
AKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLLCPLGKMRLTIPCRALTCSHLQCFD
ATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILKYCTDCDEIQFKEDGTWAPMRS
KKEVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAK
RTCPSLSPTSPLNNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPMPY
DLQGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGS
TSLPTTNGSSSGSNSSLVSSNSLRESHSHTVTNRSSTDTASIFGIIPDIISLD
NT seq 1962 nt   +upstreamnt  +downstreamnt
atgtttacactccaagattcgtatattaagcaaatggttatgagccttagagtttctgaa
ctccaagtactgttgggctacgctgggagaaacaagcacggacgcaaacacgaacttctc
acaaaagccctgcatttgctaaaggctggctgtagtcctgctgtacaaatgaaaattaag
gaactctataggcggcggttcccgcagaaaatcatgacgcctgcagacttgtccatcccc
aacgtacattcaagtcctatgccagcaactttgtctccatctaccattccacaactcact
tacgatggtcaccctgcatcatcgccattactccctgtttctcttctgggacctaaacat
gaactggaactcccacatcttacatcagctcttcacccagtccatccggatataaaactt
caaaaattaccattttatgatttactggatgaactgataaaacccaccagtctagcatca
gacaacagtcagcgctttcgagaaacctgttttgcatttgccttgacaccacaacaagtg
cagcaaatcagtagttccatggatatttctgggaccaaatgtgacttcacagtacaggtc
cagttaaggttttgtttatcagaaaccagttgtccacaagaagatcacttcccacccaat
ctttgtgtgaaagtgaatacaaaaccttgcagccttccaggttaccttccacctacaaaa
aatggcgtggaaccaaagcgacccagccgaccaattaatatcacctcacttgtccgactg
tccacaacagtaccaaacacgattgttgtttcttggactgcagaaattggaagaaactat
tccatggcagtatatcttgtaaaacagttgtcctcaacagttcttcttcagaggttacga
gcaaagggaataaggaatccggatcattctagagctttaattaaagagaagttgactgcg
gatccagacagtgaaatagctacaaccagcctaagggtttctctactatgtccacttggt
aaaatgcggctgacaattccgtgtcgggcccttacatgttctcatctacaatgttttgac
gcaactctttacattcagatgaatgagaaaaaaccaacctgggtttgtcctgtctgtgat
aagaaggctccatatgaacaccttattattgatggcttgtttatggaaatcctaaagtac
tgtacagactgtgatgaaatacaatttaaggaggatggcacttgggcaccgatgagatca
aaaaaggaagtacaggaagtttctgcctcttacaatggagtcgatggatgcttgagctcc
acattggagcatcaggtagcgtctcaccaccagtcctcaaataaaaacaagaaagtagaa
gtgattgacctaaccatagacagttcatctgatgaagaggaagaagagccatctgccaag
aggacctgtccttccctatctcccacatcaccactaaataataaaggcattttaagtctt
ccacatcaagcatctccagtatcccgcaccccaagccttcctgctgtagacacaagctac
attaatacctccctcatccaagactataggcatcctttccacatgacacccatgccttac
gacttacaaggattagatttctttcctttcttatcaggagacaatcagcattacaacacc
tccttgcttgccgctgcagcagcagcagtttcagatgatcaagacctcctacactcgtct
cggtttttcccgtatacctcctcacagatgtttcttgatcagttaagtgcaggaggcagt
acttctctgccaaccaccaatggaagcagtagtggcagtaacagcagcctggtttcttcc
aacagcctaagggagagccatagccacaccgtcacaaacaggagcagcacggacacggca
tccatctttggcatcataccagacattatttcattggactga

DBGET integrated database retrieval system