KEGG   Pan paniscus (bonobo): 100969217
Entry
100969217         CDS       T02283                                 

Gene name
AKT3
Definition
(RefSeq) AKT serine/threonine kinase 3
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps01522  Endocrine resistance
pps01524  Platinum drug resistance
pps04010  MAPK signaling pathway
pps04012  ErbB signaling pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04024  cAMP signaling pathway
pps04062  Chemokine signaling pathway
pps04066  HIF-1 signaling pathway
pps04068  FoxO signaling pathway
pps04071  Sphingolipid signaling pathway
pps04072  Phospholipase D signaling pathway
pps04140  Autophagy - animal
pps04150  mTOR signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04152  AMPK signaling pathway
pps04210  Apoptosis
pps04211  Longevity regulating pathway
pps04213  Longevity regulating pathway - multiple species
pps04218  Cellular senescence
pps04261  Adrenergic signaling in cardiomyocytes
pps04370  VEGF signaling pathway
pps04371  Apelin signaling pathway
pps04380  Osteoclast differentiation
pps04510  Focal adhesion
pps04550  Signaling pathways regulating pluripotency of stem cells
pps04611  Platelet activation
pps04613  Neutrophil extracellular trap formation
pps04620  Toll-like receptor signaling pathway
pps04625  C-type lectin receptor signaling pathway
pps04630  JAK-STAT signaling pathway
pps04660  T cell receptor signaling pathway
pps04662  B cell receptor signaling pathway
pps04664  Fc epsilon RI signaling pathway
pps04666  Fc gamma R-mediated phagocytosis
pps04668  TNF signaling pathway
pps04722  Neurotrophin signaling pathway
pps04725  Cholinergic synapse
pps04728  Dopaminergic synapse
pps04910  Insulin signaling pathway
pps04914  Progesterone-mediated oocyte maturation
pps04915  Estrogen signaling pathway
pps04917  Prolactin signaling pathway
pps04919  Thyroid hormone signaling pathway
pps04920  Adipocytokine signaling pathway
pps04922  Glucagon signaling pathway
pps04923  Regulation of lipolysis in adipocytes
pps04926  Relaxin signaling pathway
pps04929  GnRH secretion
pps04931  Insulin resistance
pps04932  Non-alcoholic fatty liver disease
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps04935  Growth hormone synthesis, secretion and action
pps04973  Carbohydrate digestion and absorption
pps05010  Alzheimer disease
pps05017  Spinocerebellar ataxia
pps05132  Salmonella infection
pps05135  Yersinia infection
pps05142  Chagas disease
pps05145  Toxoplasmosis
pps05152  Tuberculosis
pps05160  Hepatitis C
pps05161  Hepatitis B
pps05162  Measles
pps05163  Human cytomegalovirus infection
pps05164  Influenza A
pps05165  Human papillomavirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05200  Pathways in cancer
pps05205  Proteoglycans in cancer
pps05210  Colorectal cancer
pps05211  Renal cell carcinoma
pps05212  Pancreatic cancer
pps05213  Endometrial cancer
pps05214  Glioma
pps05215  Prostate cancer
pps05218  Melanoma
pps05220  Chronic myeloid leukemia
pps05221  Acute myeloid leukemia
pps05222  Small cell lung cancer
pps05223  Non-small cell lung cancer
pps05224  Breast cancer
pps05225  Hepatocellular carcinoma
pps05226  Gastric cancer
pps05230  Central carbon metabolism in cancer
pps05231  Choline metabolism in cancer
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pps05415  Diabetic cardiomyopathy
pps05417  Lipid and atherosclerosis
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100969217 (AKT3)
   04012 ErbB signaling pathway
    100969217 (AKT3)
   04014 Ras signaling pathway
    100969217 (AKT3)
   04015 Rap1 signaling pathway
    100969217 (AKT3)
   04370 VEGF signaling pathway
    100969217 (AKT3)
   04371 Apelin signaling pathway
    100969217 (AKT3)
   04630 JAK-STAT signaling pathway
    100969217 (AKT3)
   04668 TNF signaling pathway
    100969217 (AKT3)
   04066 HIF-1 signaling pathway
    100969217 (AKT3)
   04068 FoxO signaling pathway
    100969217 (AKT3)
   04072 Phospholipase D signaling pathway
    100969217 (AKT3)
   04071 Sphingolipid signaling pathway
    100969217 (AKT3)
   04024 cAMP signaling pathway
    100969217 (AKT3)
   04022 cGMP-PKG signaling pathway
    100969217 (AKT3)
   04151 PI3K-Akt signaling pathway
    100969217 (AKT3)
   04152 AMPK signaling pathway
    100969217 (AKT3)
   04150 mTOR signaling pathway
    100969217 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100969217 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    100969217 (AKT3)
   04218 Cellular senescence
    100969217 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100969217 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    100969217 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100969217 (AKT3)
   04613 Neutrophil extracellular trap formation
    100969217 (AKT3)
   04620 Toll-like receptor signaling pathway
    100969217 (AKT3)
   04625 C-type lectin receptor signaling pathway
    100969217 (AKT3)
   04660 T cell receptor signaling pathway
    100969217 (AKT3)
   04662 B cell receptor signaling pathway
    100969217 (AKT3)
   04664 Fc epsilon RI signaling pathway
    100969217 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    100969217 (AKT3)
   04062 Chemokine signaling pathway
    100969217 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100969217 (AKT3)
   04922 Glucagon signaling pathway
    100969217 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    100969217 (AKT3)
   04920 Adipocytokine signaling pathway
    100969217 (AKT3)
   04929 GnRH secretion
    100969217 (AKT3)
   04915 Estrogen signaling pathway
    100969217 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    100969217 (AKT3)
   04917 Prolactin signaling pathway
    100969217 (AKT3)
   04926 Relaxin signaling pathway
    100969217 (AKT3)
   04935 Growth hormone synthesis, secretion and action
    100969217 (AKT3)
   04919 Thyroid hormone signaling pathway
    100969217 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100969217 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100969217 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    100969217 (AKT3)
   04728 Dopaminergic synapse
    100969217 (AKT3)
   04722 Neurotrophin signaling pathway
    100969217 (AKT3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100969217 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    100969217 (AKT3)
   04213 Longevity regulating pathway - multiple species
    100969217 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100969217 (AKT3)
   05205 Proteoglycans in cancer
    100969217 (AKT3)
   05230 Central carbon metabolism in cancer
    100969217 (AKT3)
   05231 Choline metabolism in cancer
    100969217 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100969217 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100969217 (AKT3)
   05212 Pancreatic cancer
    100969217 (AKT3)
   05225 Hepatocellular carcinoma
    100969217 (AKT3)
   05226 Gastric cancer
    100969217 (AKT3)
   05214 Glioma
    100969217 (AKT3)
   05221 Acute myeloid leukemia
    100969217 (AKT3)
   05220 Chronic myeloid leukemia
    100969217 (AKT3)
   05218 Melanoma
    100969217 (AKT3)
   05211 Renal cell carcinoma
    100969217 (AKT3)
   05215 Prostate cancer
    100969217 (AKT3)
   05213 Endometrial cancer
    100969217 (AKT3)
   05224 Breast cancer
    100969217 (AKT3)
   05222 Small cell lung cancer
    100969217 (AKT3)
   05223 Non-small cell lung cancer
    100969217 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100969217 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    100969217 (AKT3)
   05161 Hepatitis B
    100969217 (AKT3)
   05160 Hepatitis C
    100969217 (AKT3)
   05164 Influenza A
    100969217 (AKT3)
   05162 Measles
    100969217 (AKT3)
   05168 Herpes simplex virus 1 infection
    100969217 (AKT3)
   05163 Human cytomegalovirus infection
    100969217 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100969217 (AKT3)
   05169 Epstein-Barr virus infection
    100969217 (AKT3)
   05165 Human papillomavirus infection
    100969217 (AKT3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100969217 (AKT3)
   05135 Yersinia infection
    100969217 (AKT3)
   05152 Tuberculosis
    100969217 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100969217 (AKT3)
   05142 Chagas disease
    100969217 (AKT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100969217 (AKT3)
   05017 Spinocerebellar ataxia
    100969217 (AKT3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100969217 (AKT3)
   05418 Fluid shear stress and atherosclerosis
    100969217 (AKT3)
   05415 Diabetic cardiomyopathy
    100969217 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100969217 (AKT3)
   04931 Insulin resistance
    100969217 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100969217 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100969217 (AKT3)
   01524 Platinum drug resistance
    100969217 (AKT3)
   01522 Endocrine resistance
    100969217 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100969217 (AKT3)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100969217 (AKT3)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100969217 (AKT3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C ABC1 PH_11
Other DBs
NCBI-GeneID: 100969217
NCBI-ProteinID: XP_003808050
UniProt: A0A2R9BCQ8
Position
1
AA seq 479 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgttaccattgtgaaagaaggttgggttcagaagaggggagaatatataaaa
aactggaggccaagatacttccttttgaagacagatggctcattcataggatataaagag
aaacctcaagatgtggatttaccttatcccctcaacaacttttcagtggcaaaatgccaa
ttaatgaaaacagaacgaccaaagccaaacacatttataatcagatgtctccagtggacc
actgttatagagagaacatttcatgtagatactccagaggaaagggaagaatggacagaa
gctatccaggctgtagcggacagactgcagaggcaagaagaggagagaatgaattgtagt
ccaacttcacaaattgataatataggagaggaagagatggatgcctctacaacccatcat
aaaagaaagacaatgaatgattttgactatttgaaactactaggtaaaggcacttttggg
aaagttattttggttcgagagaaggcaagtggaaaatattatgctatgaagattctgaag
aaagaagtcattattgcaaaggatgaagtggcacacactctaactgaaagcagagtatta
aagaacactagacatccctttttaacatccttgaaatattccttccagacaaaagaccgt
ttgtgttttgtgatggaatatgttaatgggggcgagctgtttttccatttgtcgagagag
cgggtgttctctgaggaccgcacacgtttctatggtgcagaaattgtctctgccttggac
tatctacattccggaaagattgtgtaccgtgatctcaagttggagaatctaatgctggac
aaagatggccacataaaaattacagattttggactttgcaaagaagggatcacagatgca
gccaccatgaagacattctgtggcactccagaatatctggcaccagaggtgttagaagat
aatgactatggccgagcagtagactggtggggcctaggggttgtcatgtatgaaatgatg
tgtgggaggttacctttctacaaccaggaccatgagaaactttttgaattaatattaatg
gaagacattaaatttcctcgaacactctcttcagatgcaaaatcattgctttcagggctc
ttgataaaggatccaaataaacgccttggtggaggaccagatgatgcaaaagaaattatg
agacacagtttcttctctggagtaaactggcaagatgtatatgataaaaagcttgtacct
ccttttaaacctcaagtaacatctgagacagatactagatattttgatgaagaatttaca
gctcagactattacaataacaccacctgaaaaatatgatgaggatggtatggactgcatg
gacaatgagaggcggccgcatttccctcaattttcctactctgcaagtggacgagaataa

KEGG   Pan paniscus (bonobo): 100969444
Entry
100969444         CDS       T02283                                 

Gene name
AKT1
Definition
(RefSeq) AKT serine/threonine kinase 1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps01522  Endocrine resistance
pps01524  Platinum drug resistance
pps04010  MAPK signaling pathway
pps04012  ErbB signaling pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04024  cAMP signaling pathway
pps04062  Chemokine signaling pathway
pps04066  HIF-1 signaling pathway
pps04068  FoxO signaling pathway
pps04071  Sphingolipid signaling pathway
pps04072  Phospholipase D signaling pathway
pps04140  Autophagy - animal
pps04150  mTOR signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04152  AMPK signaling pathway
pps04210  Apoptosis
pps04211  Longevity regulating pathway
pps04213  Longevity regulating pathway - multiple species
pps04218  Cellular senescence
pps04261  Adrenergic signaling in cardiomyocytes
pps04370  VEGF signaling pathway
pps04371  Apelin signaling pathway
pps04380  Osteoclast differentiation
pps04510  Focal adhesion
pps04550  Signaling pathways regulating pluripotency of stem cells
pps04611  Platelet activation
pps04613  Neutrophil extracellular trap formation
pps04620  Toll-like receptor signaling pathway
pps04625  C-type lectin receptor signaling pathway
pps04630  JAK-STAT signaling pathway
pps04660  T cell receptor signaling pathway
pps04662  B cell receptor signaling pathway
pps04664  Fc epsilon RI signaling pathway
pps04666  Fc gamma R-mediated phagocytosis
pps04668  TNF signaling pathway
pps04722  Neurotrophin signaling pathway
pps04725  Cholinergic synapse
pps04728  Dopaminergic synapse
pps04910  Insulin signaling pathway
pps04914  Progesterone-mediated oocyte maturation
pps04915  Estrogen signaling pathway
pps04917  Prolactin signaling pathway
pps04919  Thyroid hormone signaling pathway
pps04920  Adipocytokine signaling pathway
pps04922  Glucagon signaling pathway
pps04923  Regulation of lipolysis in adipocytes
pps04926  Relaxin signaling pathway
pps04929  GnRH secretion
pps04931  Insulin resistance
pps04932  Non-alcoholic fatty liver disease
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps04935  Growth hormone synthesis, secretion and action
pps04973  Carbohydrate digestion and absorption
pps05010  Alzheimer disease
pps05017  Spinocerebellar ataxia
pps05132  Salmonella infection
pps05135  Yersinia infection
pps05142  Chagas disease
pps05145  Toxoplasmosis
pps05152  Tuberculosis
pps05160  Hepatitis C
pps05161  Hepatitis B
pps05162  Measles
pps05163  Human cytomegalovirus infection
pps05164  Influenza A
pps05165  Human papillomavirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05200  Pathways in cancer
pps05205  Proteoglycans in cancer
pps05210  Colorectal cancer
pps05211  Renal cell carcinoma
pps05212  Pancreatic cancer
pps05213  Endometrial cancer
pps05214  Glioma
pps05215  Prostate cancer
pps05218  Melanoma
pps05220  Chronic myeloid leukemia
pps05221  Acute myeloid leukemia
pps05222  Small cell lung cancer
pps05223  Non-small cell lung cancer
pps05224  Breast cancer
pps05225  Hepatocellular carcinoma
pps05226  Gastric cancer
pps05230  Central carbon metabolism in cancer
pps05231  Choline metabolism in cancer
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pps05415  Diabetic cardiomyopathy
pps05417  Lipid and atherosclerosis
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100969444 (AKT1)
   04012 ErbB signaling pathway
    100969444 (AKT1)
   04014 Ras signaling pathway
    100969444 (AKT1)
   04015 Rap1 signaling pathway
    100969444 (AKT1)
   04370 VEGF signaling pathway
    100969444 (AKT1)
   04371 Apelin signaling pathway
    100969444 (AKT1)
   04630 JAK-STAT signaling pathway
    100969444 (AKT1)
   04668 TNF signaling pathway
    100969444 (AKT1)
   04066 HIF-1 signaling pathway
    100969444 (AKT1)
   04068 FoxO signaling pathway
    100969444 (AKT1)
   04072 Phospholipase D signaling pathway
    100969444 (AKT1)
   04071 Sphingolipid signaling pathway
    100969444 (AKT1)
   04024 cAMP signaling pathway
    100969444 (AKT1)
   04022 cGMP-PKG signaling pathway
    100969444 (AKT1)
   04151 PI3K-Akt signaling pathway
    100969444 (AKT1)
   04152 AMPK signaling pathway
    100969444 (AKT1)
   04150 mTOR signaling pathway
    100969444 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100969444 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    100969444 (AKT1)
   04218 Cellular senescence
    100969444 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100969444 (AKT1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100969444 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100969444 (AKT1)
   04613 Neutrophil extracellular trap formation
    100969444 (AKT1)
   04620 Toll-like receptor signaling pathway
    100969444 (AKT1)
   04625 C-type lectin receptor signaling pathway
    100969444 (AKT1)
   04660 T cell receptor signaling pathway
    100969444 (AKT1)
   04662 B cell receptor signaling pathway
    100969444 (AKT1)
   04664 Fc epsilon RI signaling pathway
    100969444 (AKT1)
   04666 Fc gamma R-mediated phagocytosis
    100969444 (AKT1)
   04062 Chemokine signaling pathway
    100969444 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100969444 (AKT1)
   04922 Glucagon signaling pathway
    100969444 (AKT1)
   04923 Regulation of lipolysis in adipocytes
    100969444 (AKT1)
   04920 Adipocytokine signaling pathway
    100969444 (AKT1)
   04929 GnRH secretion
    100969444 (AKT1)
   04915 Estrogen signaling pathway
    100969444 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    100969444 (AKT1)
   04917 Prolactin signaling pathway
    100969444 (AKT1)
   04926 Relaxin signaling pathway
    100969444 (AKT1)
   04935 Growth hormone synthesis, secretion and action
    100969444 (AKT1)
   04919 Thyroid hormone signaling pathway
    100969444 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100969444 (AKT1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100969444 (AKT1)
  09156 Nervous system
   04725 Cholinergic synapse
    100969444 (AKT1)
   04728 Dopaminergic synapse
    100969444 (AKT1)
   04722 Neurotrophin signaling pathway
    100969444 (AKT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100969444 (AKT1)
  09149 Aging
   04211 Longevity regulating pathway
    100969444 (AKT1)
   04213 Longevity regulating pathway - multiple species
    100969444 (AKT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100969444 (AKT1)
   05205 Proteoglycans in cancer
    100969444 (AKT1)
   05230 Central carbon metabolism in cancer
    100969444 (AKT1)
   05231 Choline metabolism in cancer
    100969444 (AKT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100969444 (AKT1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100969444 (AKT1)
   05212 Pancreatic cancer
    100969444 (AKT1)
   05225 Hepatocellular carcinoma
    100969444 (AKT1)
   05226 Gastric cancer
    100969444 (AKT1)
   05214 Glioma
    100969444 (AKT1)
   05221 Acute myeloid leukemia
    100969444 (AKT1)
   05220 Chronic myeloid leukemia
    100969444 (AKT1)
   05218 Melanoma
    100969444 (AKT1)
   05211 Renal cell carcinoma
    100969444 (AKT1)
   05215 Prostate cancer
    100969444 (AKT1)
   05213 Endometrial cancer
    100969444 (AKT1)
   05224 Breast cancer
    100969444 (AKT1)
   05222 Small cell lung cancer
    100969444 (AKT1)
   05223 Non-small cell lung cancer
    100969444 (AKT1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100969444 (AKT1)
   05170 Human immunodeficiency virus 1 infection
    100969444 (AKT1)
   05161 Hepatitis B
    100969444 (AKT1)
   05160 Hepatitis C
    100969444 (AKT1)
   05164 Influenza A
    100969444 (AKT1)
   05162 Measles
    100969444 (AKT1)
   05168 Herpes simplex virus 1 infection
    100969444 (AKT1)
   05163 Human cytomegalovirus infection
    100969444 (AKT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100969444 (AKT1)
   05169 Epstein-Barr virus infection
    100969444 (AKT1)
   05165 Human papillomavirus infection
    100969444 (AKT1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100969444 (AKT1)
   05135 Yersinia infection
    100969444 (AKT1)
   05152 Tuberculosis
    100969444 (AKT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100969444 (AKT1)
   05142 Chagas disease
    100969444 (AKT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100969444 (AKT1)
   05017 Spinocerebellar ataxia
    100969444 (AKT1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100969444 (AKT1)
   05418 Fluid shear stress and atherosclerosis
    100969444 (AKT1)
   05415 Diabetic cardiomyopathy
    100969444 (AKT1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100969444 (AKT1)
   04931 Insulin resistance
    100969444 (AKT1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100969444 (AKT1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100969444 (AKT1)
   01524 Platinum drug resistance
    100969444 (AKT1)
   01522 Endocrine resistance
    100969444 (AKT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100969444 (AKT1)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100969444 (AKT1)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100969444 (AKT1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal ABC1 APH
Other DBs
NCBI-GeneID: 100969444
NCBI-ProteinID: XP_003807047
UniProt: A0A2R9BZ66
Position
14
AA seq 480 aa
MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgagcgacgtggctattgtgaaggagggctggctgcacaaacgaggggagtacatcaag
acctggcggccacgctacttcctcctcaagaatgatggcaccttcattggctacaaggag
cggccgcaggatgtggaccaacgtgaggcccccctcaacaacttctctgtggcgcagtgc
cagctgatgaagacggagcggcctcggcccaacaccttcatcatccgctgcctgcagtgg
accactgtcatcgaacgcaccttccatgtggagactcctgaggagcgggaggagtggaca
accgccatccagactgtggccgacggcctcaagaagcaggaggaggaggagatggacttc
cggtcgggctcacccagtgacaactcaggggctgaagagatggaggtgtccctggccaag
cccaagcaccgcgtgaccatgaacgagtttgagtacctgaagctgctgggcaagggcact
ttcggcaaggtgatcctggtgaaggagaaggccacaggccgctactacgccatgaagatc
ctcaagaaggaagtcatcgtggccaaggacgaggtggcccacacactcaccgagaaccgc
gtcctgcagaactccaggcaccccttcctcacagccctgaagtactctttccagacccac
gaccgcctctgcttcgtcatggagtacgccaacgggggcgagctgttcttccacctgtcc
cgggagcgtgtgttctccgaggaccgggcccgcttctatggcgctgagatcgtgtcagcc
ctggactacctgcactcggagaagaacgtggtgtaccgggacctcaagctggagaacctc
atgctggacaaggacgggcacattaagatcacagacttcgggctgtgcaaggaggggatc
aaggacggtgccaccatgaagaccttttgtggcacacccgagtacctggcccccgaggtg
ctggaggacaatgactacggccgtgcagtggactggtgggggctgggcgtggtcatgtac
gagatgatgtgcggccgcctgcccttctacaaccaggaccatgagaagctttttgagctc
atcctcatggaggagatccgcttcccgcgcacgcttggtcccgaggccaagtccttgctt
tcggggctgctcaagaaggaccccaagcagaggcttggcgggggctccgaggacgccaag
gagatcatgcagcatcgcttctttgccggtatcgtgtggcagcacgtgtacgagaagaag
ctcagcccacccttcaagccccaggtcacatcggagactgacaccaggtattttgatgag
gagttcacggcccagatgatcaccatcacaccacctgaccaagatgacagcatggagtgt
gtggacagcgagcgcaggccccacttcccccagttctcctactcggccagcggcacggcc
tga

KEGG   Pan paniscus (bonobo): 100991804
Entry
100991804         CDS       T02283                                 

Gene name
AKT2
Definition
(RefSeq) AKT serine/threonine kinase 2
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps01522  Endocrine resistance
pps01524  Platinum drug resistance
pps04010  MAPK signaling pathway
pps04012  ErbB signaling pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04024  cAMP signaling pathway
pps04062  Chemokine signaling pathway
pps04066  HIF-1 signaling pathway
pps04068  FoxO signaling pathway
pps04071  Sphingolipid signaling pathway
pps04072  Phospholipase D signaling pathway
pps04140  Autophagy - animal
pps04150  mTOR signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04152  AMPK signaling pathway
pps04210  Apoptosis
pps04211  Longevity regulating pathway
pps04213  Longevity regulating pathway - multiple species
pps04218  Cellular senescence
pps04261  Adrenergic signaling in cardiomyocytes
pps04370  VEGF signaling pathway
pps04371  Apelin signaling pathway
pps04380  Osteoclast differentiation
pps04510  Focal adhesion
pps04550  Signaling pathways regulating pluripotency of stem cells
pps04611  Platelet activation
pps04613  Neutrophil extracellular trap formation
pps04620  Toll-like receptor signaling pathway
pps04625  C-type lectin receptor signaling pathway
pps04630  JAK-STAT signaling pathway
pps04660  T cell receptor signaling pathway
pps04662  B cell receptor signaling pathway
pps04664  Fc epsilon RI signaling pathway
pps04666  Fc gamma R-mediated phagocytosis
pps04668  TNF signaling pathway
pps04722  Neurotrophin signaling pathway
pps04725  Cholinergic synapse
pps04728  Dopaminergic synapse
pps04910  Insulin signaling pathway
pps04914  Progesterone-mediated oocyte maturation
pps04915  Estrogen signaling pathway
pps04917  Prolactin signaling pathway
pps04919  Thyroid hormone signaling pathway
pps04920  Adipocytokine signaling pathway
pps04922  Glucagon signaling pathway
pps04923  Regulation of lipolysis in adipocytes
pps04926  Relaxin signaling pathway
pps04929  GnRH secretion
pps04931  Insulin resistance
pps04932  Non-alcoholic fatty liver disease
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps04935  Growth hormone synthesis, secretion and action
pps04973  Carbohydrate digestion and absorption
pps05010  Alzheimer disease
pps05017  Spinocerebellar ataxia
pps05132  Salmonella infection
pps05135  Yersinia infection
pps05142  Chagas disease
pps05145  Toxoplasmosis
pps05152  Tuberculosis
pps05160  Hepatitis C
pps05161  Hepatitis B
pps05162  Measles
pps05163  Human cytomegalovirus infection
pps05164  Influenza A
pps05165  Human papillomavirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05200  Pathways in cancer
pps05205  Proteoglycans in cancer
pps05210  Colorectal cancer
pps05211  Renal cell carcinoma
pps05212  Pancreatic cancer
pps05213  Endometrial cancer
pps05214  Glioma
pps05215  Prostate cancer
pps05218  Melanoma
pps05220  Chronic myeloid leukemia
pps05221  Acute myeloid leukemia
pps05222  Small cell lung cancer
pps05223  Non-small cell lung cancer
pps05224  Breast cancer
pps05225  Hepatocellular carcinoma
pps05226  Gastric cancer
pps05230  Central carbon metabolism in cancer
pps05231  Choline metabolism in cancer
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pps05415  Diabetic cardiomyopathy
pps05417  Lipid and atherosclerosis
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100991804 (AKT2)
   04012 ErbB signaling pathway
    100991804 (AKT2)
   04014 Ras signaling pathway
    100991804 (AKT2)
   04015 Rap1 signaling pathway
    100991804 (AKT2)
   04370 VEGF signaling pathway
    100991804 (AKT2)
   04371 Apelin signaling pathway
    100991804 (AKT2)
   04630 JAK-STAT signaling pathway
    100991804 (AKT2)
   04668 TNF signaling pathway
    100991804 (AKT2)
   04066 HIF-1 signaling pathway
    100991804 (AKT2)
   04068 FoxO signaling pathway
    100991804 (AKT2)
   04072 Phospholipase D signaling pathway
    100991804 (AKT2)
   04071 Sphingolipid signaling pathway
    100991804 (AKT2)
   04024 cAMP signaling pathway
    100991804 (AKT2)
   04022 cGMP-PKG signaling pathway
    100991804 (AKT2)
   04151 PI3K-Akt signaling pathway
    100991804 (AKT2)
   04152 AMPK signaling pathway
    100991804 (AKT2)
   04150 mTOR signaling pathway
    100991804 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100991804 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    100991804 (AKT2)
   04218 Cellular senescence
    100991804 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100991804 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    100991804 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100991804 (AKT2)
   04613 Neutrophil extracellular trap formation
    100991804 (AKT2)
   04620 Toll-like receptor signaling pathway
    100991804 (AKT2)
   04625 C-type lectin receptor signaling pathway
    100991804 (AKT2)
   04660 T cell receptor signaling pathway
    100991804 (AKT2)
   04662 B cell receptor signaling pathway
    100991804 (AKT2)
   04664 Fc epsilon RI signaling pathway
    100991804 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    100991804 (AKT2)
   04062 Chemokine signaling pathway
    100991804 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100991804 (AKT2)
   04922 Glucagon signaling pathway
    100991804 (AKT2)
   04923 Regulation of lipolysis in adipocytes
    100991804 (AKT2)
   04920 Adipocytokine signaling pathway
    100991804 (AKT2)
   04929 GnRH secretion
    100991804 (AKT2)
   04915 Estrogen signaling pathway
    100991804 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    100991804 (AKT2)
   04917 Prolactin signaling pathway
    100991804 (AKT2)
   04926 Relaxin signaling pathway
    100991804 (AKT2)
   04935 Growth hormone synthesis, secretion and action
    100991804 (AKT2)
   04919 Thyroid hormone signaling pathway
    100991804 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100991804 (AKT2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100991804 (AKT2)
  09156 Nervous system
   04725 Cholinergic synapse
    100991804 (AKT2)
   04728 Dopaminergic synapse
    100991804 (AKT2)
   04722 Neurotrophin signaling pathway
    100991804 (AKT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100991804 (AKT2)
  09149 Aging
   04211 Longevity regulating pathway
    100991804 (AKT2)
   04213 Longevity regulating pathway - multiple species
    100991804 (AKT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100991804 (AKT2)
   05205 Proteoglycans in cancer
    100991804 (AKT2)
   05230 Central carbon metabolism in cancer
    100991804 (AKT2)
   05231 Choline metabolism in cancer
    100991804 (AKT2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100991804 (AKT2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100991804 (AKT2)
   05212 Pancreatic cancer
    100991804 (AKT2)
   05225 Hepatocellular carcinoma
    100991804 (AKT2)
   05226 Gastric cancer
    100991804 (AKT2)
   05214 Glioma
    100991804 (AKT2)
   05221 Acute myeloid leukemia
    100991804 (AKT2)
   05220 Chronic myeloid leukemia
    100991804 (AKT2)
   05218 Melanoma
    100991804 (AKT2)
   05211 Renal cell carcinoma
    100991804 (AKT2)
   05215 Prostate cancer
    100991804 (AKT2)
   05213 Endometrial cancer
    100991804 (AKT2)
   05224 Breast cancer
    100991804 (AKT2)
   05222 Small cell lung cancer
    100991804 (AKT2)
   05223 Non-small cell lung cancer
    100991804 (AKT2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100991804 (AKT2)
   05170 Human immunodeficiency virus 1 infection
    100991804 (AKT2)
   05161 Hepatitis B
    100991804 (AKT2)
   05160 Hepatitis C
    100991804 (AKT2)
   05164 Influenza A
    100991804 (AKT2)
   05162 Measles
    100991804 (AKT2)
   05168 Herpes simplex virus 1 infection
    100991804 (AKT2)
   05163 Human cytomegalovirus infection
    100991804 (AKT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100991804 (AKT2)
   05169 Epstein-Barr virus infection
    100991804 (AKT2)
   05165 Human papillomavirus infection
    100991804 (AKT2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100991804 (AKT2)
   05135 Yersinia infection
    100991804 (AKT2)
   05152 Tuberculosis
    100991804 (AKT2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100991804 (AKT2)
   05142 Chagas disease
    100991804 (AKT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100991804 (AKT2)
   05017 Spinocerebellar ataxia
    100991804 (AKT2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100991804 (AKT2)
   05418 Fluid shear stress and atherosclerosis
    100991804 (AKT2)
   05415 Diabetic cardiomyopathy
    100991804 (AKT2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100991804 (AKT2)
   04931 Insulin resistance
    100991804 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100991804 (AKT2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100991804 (AKT2)
   01524 Platinum drug resistance
    100991804 (AKT2)
   01522 Endocrine resistance
    100991804 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100991804 (AKT2)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100991804 (AKT2)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100991804 (AKT2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C ABC1
Other DBs
NCBI-GeneID: 100991804
NCBI-ProteinID: XP_003812539
UniProt: A0A2R9A1U2
Position
19
AA seq 481 aa
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRAPGEDPM
DYKCGSPSDSSMAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIR
E
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaacgaggtgtctgtcatcaaagaaggctggctccacaagcgtggtgaatacatcaag
acctggaggccacggtacttcctgctgaagagcgacggctccttcattgggtacaaggag
aggcccgaggcccctgatcagactctaccccccttaaacaacttctccgtagcagaatgc
cagctgatgaagaccgagaggccgcgacccaacacctttgtcatacgctgcctgcagtgg
accacagtcatcgagaggaccttccacgtggattctccagatgagagggaggaatggatg
cgggccatccagatggtcgccaacagcctcaagcagcgggccccaggcgaggaccccatg
gactacaagtgtggctcccccagtgactcctctatggctgaggagatggaagtggcggtc
agcaaggcacgggctaaagtgaccatgaatgacttcgactatctcaaactccttggcaag
ggaacctttggcaaagtcatcctggtgcgggagaaggccactggccgctactacgccatg
aagatcctgcggaaggaagtcatcattgccaaggatgaagtcgctcacacagtcaccgag
agccgagtcctccagaacaccaggcacccgttcctcactgcgctgaagtacgccttccag
acccacgaccgcctgtgctttgtgatggagtatgccaacgggggtgagctgttcttccac
ctgtcccgggagcgtgtcttcacagaggagcgggcccggttttatggtgcagagattgtc
tcggctcttgagtacttgcactcacgggacgtggtataccgcgacatcaagctggaaaac
ctcatgctggacaaagatggccacatcaagatcactgactttggcctctgcaaagagggc
atcagtgacggggccaccatgaaaaccttctgtgggaccccggagtacctggcgcctgag
gtgctggaggacaatgactatggccgggccgtggactggtgggggctgggtgtggtcatg
tacgagatgatgtgcggccgcctgcccttctacaaccaggaccacgagcgcctcttcgag
ctcatcctcatggaagagatccgcttcccgcgcacgctcagccccgaggccaagtccctg
cttgctgggctgcttaagaaggaccccaagcagaggcttggtggggggcccagcgatgcc
aaggaggtcatggagcacaggttcttcctcagcatcaactggcaggacgtggtccagaag
aagctcctgccacccttcaaacctcaggtcacgtccgaggtcgacacaaggtacttcgat
gatgaatttaccgcccagtccatcacaatcacaccccctgaccgctatgacagcctgggc
ttactggagctggaccagcggacccacttcccccagttctcctactcggccagcatccgg
gagtga

DBGET integrated database retrieval system