KEGG   Pan paniscus (bonobo): 100969269Help
Entry
100969269         CDS       T02283                                 

Gene name
ADH5
Definition
(RefSeq) alcohol dehydrogenase 5 (class III), chi polypeptide
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00010  Glycolysis / Gluconeogenesis
pps00071  Fatty acid degradation
pps00350  Tyrosine metabolism
pps00830  Retinol metabolism
pps00980  Metabolism of xenobiotics by cytochrome P450
pps00982  Drug metabolism - cytochrome P450
pps01100  Metabolic pathways
pps01200  Carbon metabolism
pps05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100969269 (ADH5)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100969269 (ADH5)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    100969269 (ADH5)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100969269 (ADH5)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100969269 (ADH5)
   00982 Drug metabolism - cytochrome P450
    100969269 (ADH5)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    100969269 (ADH5)
Enzymes [BR:pps01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     100969269 (ADH5)
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     100969269 (ADH5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 100969269
NCBI-ProteinID: XP_003829971
Position
4
AA seq 374 aa AA seqDB search
MANEVIKCKAAVAWEAGKPLSIEEIEVAPPKAHEVRIKIIATAVCHTDAYTLSGADPEGC
FPVILGHEGAGIVESVGEGVTKLKAGDTVIPLYIPQCGQCKFCLNPKTNLCQKIRVTQGK
GLMPDGTSRFTCKGKTILHYMGTSTFSEYTVVADISVAKIDPLAPLDKVCLLGCGISTGY
GAAVNTAKVEPGSVCAVFGLGGVGLAVIMGCKVAGASRIIGVDINKDKFARAKEFGATEC
INPQDFSKPIQEVLIEMTDGGVDYSFECIGNVKVMRAALEACHKGWGVSVVVGVAASGEE
IATRPFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDEFVTHNLSFDEINKAFE
LMHSGKSIRTVVKI
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgaggttatcaagtgcaaggctgcagttgcttgggaggctggaaagcctctc
tccatagaggagatagaggtggcacccccaaaggctcatgaagttcgaatcaagatcatt
gccactgcggtttgccacaccgatgcctataccctgagtggagctgatcctgagggttgt
tttccagtgatcttgggacatgaaggtgctggaattgtggaaagtgttggtgagggagtt
actaagctgaaggcgggtgacactgtcatcccactttacatcccacagtgtggacaatgc
aaattttgtctaaatcctaaaactaacctttgccagaagataagagtcactcaagggaaa
ggattaatgccagatggtaccagcagatttacttgcaaaggaaagacaattttgcattac
atgggaaccagcacattttctgaatacacagttgtggctgatatctctgttgctaaaata
gatcctttagcacctttggataaagtctgccttctaggttgtggcatttcaaccggttat
ggtgctgctgtgaacactgccaaggtggagcctggctctgtttgtgctgtctttggtctg
ggaggagtcggattggcagttatcatgggctgtaaagtggctggtgcttcccggatcatt
ggtgtggacatcaataaagataaatttgcaagggccaaagagtttggagccactgaatgt
attaaccctcaggattttagtaaacccatccaggaagtgctcattgagatgaccgatgga
ggagtggactattcctttgaatgtattggtaatgtgaaggtcatgagagcagcacttgag
gcatgtcacaagggctggggcgtcagcgtcgtggttggagtagctgcttcaggtgaagaa
attgccactcgtccattccagctggtaacaggtcgcacatggaaaggcactgcctttgga
ggatggaagagtgtagaaagtgtcccaaagttggtgtctgaatatatgtccaaaaagata
aaagttgatgaatttgtgactcacaatctgtcttttgatgaaatcaacaaagcctttgaa
ctgatgcattctggaaagagcattcgaactgttgtaaagatttaa

DBGET integrated database retrieval system