KEGG   Pan paniscus (bonobo): 100969344Help
Entry
100969344         CDS       T02283                                 

Gene name
PLCB2
Definition
(RefSeq) phospholipase C beta 2
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00562  Inositol phosphate metabolism
pps01100  Metabolic pathways
pps04015  Rap1 signaling pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04062  Chemokine signaling pathway
pps04070  Phosphatidylinositol signaling system
pps04071  Sphingolipid signaling pathway
pps04072  Phospholipase D signaling pathway
pps04261  Adrenergic signaling in cardiomyocytes
pps04270  Vascular smooth muscle contraction
pps04310  Wnt signaling pathway
pps04371  Apelin signaling pathway
pps04540  Gap junction
pps04611  Platelet activation
pps04621  NOD-like receptor signaling pathway
pps04713  Circadian entrainment
pps04720  Long-term potentiation
pps04723  Retrograde endocannabinoid signaling
pps04724  Glutamatergic synapse
pps04725  Cholinergic synapse
pps04726  Serotonergic synapse
pps04728  Dopaminergic synapse
pps04730  Long-term depression
pps04750  Inflammatory mediator regulation of TRP channels
pps04911  Insulin secretion
pps04912  GnRH signaling pathway
pps04915  Estrogen signaling pathway
pps04916  Melanogenesis
pps04918  Thyroid hormone synthesis
pps04919  Thyroid hormone signaling pathway
pps04921  Oxytocin signaling pathway
pps04922  Glucagon signaling pathway
pps04924  Renin secretion
pps04925  Aldosterone synthesis and secretion
pps04926  Relaxin signaling pathway
pps04927  Cortisol synthesis and secretion
pps04928  Parathyroid hormone synthesis, secretion and action
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps04934  Cushing's syndrome
pps04961  Endocrine and other factor-regulated calcium reabsorption
pps04970  Salivary secretion
pps04971  Gastric acid secretion
pps04972  Pancreatic secretion
pps05010  Alzheimer's disease
pps05016  Huntington's disease
pps05142  Chagas disease (American trypanosomiasis)
pps05143  African trypanosomiasis
pps05146  Amoebiasis
pps05163  Human cytomegalovirus infection
pps05200  Pathways in cancer
Module
pps_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100969344 (PLCB2)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100969344 (PLCB2)
   04310 Wnt signaling pathway
    100969344 (PLCB2)
   04371 Apelin signaling pathway
    100969344 (PLCB2)
   04020 Calcium signaling pathway
    100969344 (PLCB2)
   04070 Phosphatidylinositol signaling system
    100969344 (PLCB2)
   04072 Phospholipase D signaling pathway
    100969344 (PLCB2)
   04071 Sphingolipid signaling pathway
    100969344 (PLCB2)
   04022 cGMP - PKG signaling pathway
    100969344 (PLCB2)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    100969344 (PLCB2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100969344 (PLCB2)
   04621 NOD-like receptor signaling pathway
    100969344 (PLCB2)
   04062 Chemokine signaling pathway
    100969344 (PLCB2)
  Endocrine system
   04911 Insulin secretion
    100969344 (PLCB2)
   04922 Glucagon signaling pathway
    100969344 (PLCB2)
   04912 GnRH signaling pathway
    100969344 (PLCB2)
   04915 Estrogen signaling pathway
    100969344 (PLCB2)
   04921 Oxytocin signaling pathway
    100969344 (PLCB2)
   04926 Relaxin signaling pathway
    100969344 (PLCB2)
   04918 Thyroid hormone synthesis
    100969344 (PLCB2)
   04919 Thyroid hormone signaling pathway
    100969344 (PLCB2)
   04928 Parathyroid hormone synthesis, secretion and action
    100969344 (PLCB2)
   04916 Melanogenesis
    100969344 (PLCB2)
   04924 Renin secretion
    100969344 (PLCB2)
   04925 Aldosterone synthesis and secretion
    100969344 (PLCB2)
   04927 Cortisol synthesis and secretion
    100969344 (PLCB2)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100969344 (PLCB2)
   04270 Vascular smooth muscle contraction
    100969344 (PLCB2)
  Digestive system
   04970 Salivary secretion
    100969344 (PLCB2)
   04971 Gastric acid secretion
    100969344 (PLCB2)
   04972 Pancreatic secretion
    100969344 (PLCB2)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100969344 (PLCB2)
  Nervous system
   04724 Glutamatergic synapse
    100969344 (PLCB2)
   04725 Cholinergic synapse
    100969344 (PLCB2)
   04728 Dopaminergic synapse
    100969344 (PLCB2)
   04726 Serotonergic synapse
    100969344 (PLCB2)
   04720 Long-term potentiation
    100969344 (PLCB2)
   04730 Long-term depression
    100969344 (PLCB2)
   04723 Retrograde endocannabinoid signaling
    100969344 (PLCB2)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100969344 (PLCB2)
  Environmental adaptation
   04713 Circadian entrainment
    100969344 (PLCB2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100969344 (PLCB2)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100969344 (PLCB2)
   05016 Huntington's disease
    100969344 (PLCB2)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100969344 (PLCB2)
   04934 Cushing's syndrome
    100969344 (PLCB2)
  Infectious diseases
   05163 Human cytomegalovirus infection
    100969344 (PLCB2)
   05146 Amoebiasis
    100969344 (PLCB2)
   05142 Chagas disease (American trypanosomiasis)
    100969344 (PLCB2)
   05143 African trypanosomiasis
    100969344 (PLCB2)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100969344 (PLCB2)
Membrane trafficking [BR:pps04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100969344 (PLCB2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100969344 (PLCB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLC-beta_C PI-PLC-X PI-PLC-Y EF-hand_like C2 DUF1154 Gp58
Motif
Other DBs
NCBI-GeneID: 100969344
NCBI-ProteinID: XP_003826613
Position
15
AA seq 1185 aa AA seqDB search
MSLLNPVLLPPKVKAYLSQGERFIKWDDETTVASPVILRVDPKGYYLYWTYQSKEMEFLD
ITSIRDTRFGKFAKMPKSQKLRDVFNMDFPDNSFLLKTLTVVSGPDMVDLTFHNFVSYKE
NVGKVWAEDVLALVKHPLTANASRSTFLDKILVKLKMQLNSEGKIPVKNFFQMFPADRKR
VEAALSACHLPKGKNDAINPEDFPEPVYKSFLMSLCPRPEINEIFTSYHAKAKPYMTKEH
LTKFINQKQRDSRLNSLLFPPARPDQVQGLIDKYEPSGINAQRGQLSPEGMVWFLCGPEN
SVLAQDKLLLHHDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLSGCRCVELDC
WKGKPPDEEPIITHGFTMTTDIFFKEAIEAIAESAFKTSPYPIILSFENHVDSPRQQAKM
AEYCRTIFGDMLLTEPLEKFPLKPGVPLPSPEDLRGKILIKNKKNQFSGPTSSSKDTGGE
AEGSSPPSAPAGEGTVWAGEEGTELEEEEVEEEEEEESGNLDEEEIKKMQSDEGTAGLEV
TAYEEMSSLVNYIQPTKFVSFEFSAQKNRSYVISSFTELKAYDLLSKASVQFVDYNKRQM
SRIYPKGTRMDSSNYMPQMFWNAGCQMVALNFQTMDLPMQQNMAVFEFNGQSGYLLKHEF
MRRPDKQFNPFSVDRIDVVVATTLSITVISGQFLSERSVRTYVEVELFGLPGDPKRRYRT
KLSPSTNSINPVWKEEPFVFEKILMPELASLRVAVMEEGNKFLGHRIIPINALNSGYHHL
CLHSESNMPLTMPALFIFLEMKDYIPGAWADLTVALANPIKFFSAHDTKSVKLKEAMGGL
PEKPFPLASPVASQVNGALAPTSNGSPAARAGAREEAMKEAAEPRTASLEELRELKGVVK
LQRRHEKELRELERRGARRWEELLQRGAEQLAELGPPGVGGVGACKLGPGKGSRKKRSLP
REESAGAAPGEGPEGVDGRVRELKDRLELELLRQGEEQYECVLKRKEQHAAEQISKMMEL
AREKQAAELKALKETSENDTKEMKKKLETKRLERIQGMTKVTTDKMAQERLKREINNSHI
QEVVQVIKQMTENLERHQEKLEEKQAACLEQIREMEKQFQKEALAEYEARMKGLEAEVKE
SVRACLRTCFPSEAKDKPERACECPPELCEQDPLIAKADAQESRL
NT seq 3558 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgctcaaccctgtcctgctgccccccaaggtgaaggcctatctgagccaaggg
gagcgcttcatcaaatgggatgatgaaactacagttgcctctccagttatcctccgtgtg
gatcctaagggctactacttatactggacgtatcaaagtaaggagatggagtttctggat
atcaccagcatccgggatactcgctttgggaagtttgccaagatgcccaagagccagaag
ctccgggacgtcttcaacatggactttcctgacaacagtttcctgctgaagacactcacg
gtggtgtctggcccggacatggtggacctcaccttccacaacttcgtctcctacaaggag
aacgtgggcaaggtctgggctgaggacgtactggccctagtcaaacatccgctgacggcc
aacgcctcccgcagcaccttcctggacaagatccttgtgaagctcaagatgcagctcaac
tctgaagggaagattccggtgaagaactttttccagatgtttcctgctgaccgcaagcgg
gtggaagctgctctcagtgcctgccacctccccaaaggcaaaaatgatgccatcaatcct
gaggacttcccagaacctgtctacaagagtttcctcatgagcctctgtcctcggccagaa
ataaatgagatcttcacttcttaccatgctaaggccaaaccctacatgacgaaggagcac
ctgaccaaattcatcaaccagaaacagcgggactcccggcttaactccctgctgttcccg
ccagcacggcctgaccaggtgcagggcctcatcgacaagtatgagcccagtggcatcaat
gcacagaggggccagctgtcacctgaaggcatggtctggtttctctgtgggccagagaac
agcgtgctggcccaggacaagctgctgctccaccacgacatgacgcagccactcaatcat
tacttcatcaactcgtcccacaacacctacctgacagccggccagttctcaggcctctcc
tcggctgagatgtaccgccaggtgctgctctctggctgccgttgcgtggagctagactgc
tggaaggggaaaccccctgacgaggagcccattatcacccatggcttcaccatgaccaca
gacatcttcttcaaagaagcaattgaggctattgcagaaagtgcctttaagacctccccc
tatcccatcatcctgtcttttgagaaccatgtggactcaccccgccagcaggctaagatg
gctgagtattgccggacgatctttggggatatgctgctcacagagcccctggaaaagttc
ccactaaaaccaggtgtccccctgcccagccctgaggacctcaggggcaagatcctcatc
aagaacaagaagaaccagttttctggccccacctcctccagtaaggatactggtggggag
gctgagggcagcagcccacccagtgcccctgcaggtgagggcacagtgtgggctggcgag
gaagggactgagctggaggaggaggaggtggaagaggaagaggaggaggagtcaggaaac
ctggatgaagaagagattaagaagatgcagtcggatgagggcacagcgggcctggaagtg
acggcttatgaggagatgtccagcctagtcaattacatccagcccaccaagttcgtctcc
tttgagttctctgctcaaaagaaccgaagttatgtcatctcgtccttcacagagctcaag
gcatatgacctgctctccaaggcctcggtgcagtttgtggactacaacaagcgccagatg
agccgcatttaccccaagggaacccgcatggactcctccaactacatgccccagatgttc
tggaatgctggatgccagatggttgccctcaacttccagacgatggacttgcccatgcag
cagaacatggcagtgtttgagttcaatgggcagagcggctacctcctcaagcatgagttc
atgcgccggccggacaagcagttcaaccccttctcagtggaccgcatcgacgtggtggtg
gccaccaccctttccattacggtgatctctgggcagttcctgtcagaacgcagcgtgcgc
acctatgtggaagtggagctgtttggccttcctggggaccccaagaggcgctatcgaact
aagctgtcacccagtactaactccatcaatcctgtctggaaggaggagccctttgtcttt
gagaagatcttgatgcctgagctggcctccctcagagtggctgtgatggaggaaggcaac
aagtttcttggacaccgcatcatccccatcaatgccctaaattctgggtaccaccacctg
tgcctgcacagtgagagcaacatgcccctcaccatgcctgcgctcttcatattcctggag
atgaaggactacatacctggtgcttgggcagatctcactgtggccctcgccaaccccatt
aagttcttcagtgcccatgacacgaagtctgtgaagctcaaggaggccatgggaggtctg
cctgagaagcccttcccactggcgagtccagttgccagccaggtcaatggggcgttggcc
ccaacgagcaatgggtcaccagcagccagggccggggccagggaagaggctatgaaagaa
gctgcggagccgcggaccgccagcctggaggagctccgggagctaaagggcgtggtgaag
ctgcagcggcggcacgagaaggagctgcgagagttggagcggcgcggagcgcggcgctgg
gaggagctgctgcagcggggcgcggagcagctggcggagctcgggccaccgggcgtgggg
ggtgtcggggcctgcaagctcggtcccggcaagggctctcgcaagaagaggagcctgccc
cgcgaggagagcgccggagccgcgccgggcgagggccctgagggcgtggacgggcgcgtg
cgggagctgaaagacaggctggagctggagctgctgcggcagggcgaggagcagtacgag
tgcgttctgaagcgcaaggagcagcacgcggccgagcaaatctccaaaatgatggagctg
gccagagagaaacaggcggcagagctgaaggccctgaaggagacgtcggagaacgacacc
aaagagatgaagaaaaagctggagacaaagagactggagcggatccagggcatgaccaaa
gtcaccacagacaagatggcccaggagaggttgaagagagagattaacaactcccacatc
caggaagtagtgcaggtgatcaagcagatgacggagaacttggagaggcaccaggagaag
ctggaggagaagcaggcggcttgcctggaacagatacgggagatggaaaagcagttccag
aaggaggcgctggcagagtacgaggccaggatgaagggtctggaggcagaggtgaaggag
tcggtgagggcctgcctcaggacctgctttccctctgaggccaaggacaagcctgagagg
gcctgcgagtgccccccagagctgtgtgagcaggacccactcatagcaaaggcagatgcc
caggagagccgcctctga

DBGET integrated database retrieval system