KEGG   Pan paniscus (bonobo): 100969379Help
Entry
100969379         CDS       T02283                                 

Definition
(RefSeq) septin-7-like
  KO
K16944  septin 7
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100969379
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pps04812]
    100969379
   04147 Exosome [BR:pps04147]
    100969379
Membrane trafficking [BR:pps04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    100969379
Cytoskeleton proteins [BR:pps04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     100969379
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100969379
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin HEPPP_synt_1
Motif
Other DBs
NCBI-GeneID: 100969379
NCBI-ProteinID: XP_008966099
Position
7
AA seq 83 aa AA seqDB search
KEIQEHKVKIHEFPETDDEEEKKLVKKIKDHLPLAVVGSNTIIEVNGKRVIGRQYPWSVA
EVENGEHCDFTVLRNMLIRPQRS
NT seq 254 nt NT seq  +upstreamnt  +downstreamnt
ataaagaaatccaagaacataaagttaaaatacatgaatttccagaaacagatgatgaag
aagaaaaaaaacttgttaaaaagataaaggaccatttacctcttgctgtggtgggtagta
atactatcattgaagttaatggcaaaagggtcataggaaggcagtatccttggagtgttg
ctgaagttgaaaatggtgaacattgtgattttacagttctaagaaatatgttgataagac
ctcaaaggagttaa

DBGET integrated database retrieval system