KEGG   Pan paniscus (bonobo): 100969387
Entry
100969387         CDS       T02283                                 

Gene name
INS
Definition
(RefSeq) insulin
  KO
K04526  insulin
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04066  HIF-1 signaling pathway
pps04068  FoxO signaling pathway
pps04072  Phospholipase D signaling pathway
pps04114  Oocyte meiosis
pps04140  Autophagy - animal
pps04150  mTOR signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04152  AMPK signaling pathway
pps04211  Longevity regulating pathway
pps04213  Longevity regulating pathway - multiple species
pps04810  Regulation of actin cytoskeleton
pps04910  Insulin signaling pathway
pps04911  Insulin secretion
pps04913  Ovarian steroidogenesis
pps04914  Progesterone-mediated oocyte maturation
pps04917  Prolactin signaling pathway
pps04923  Regulation of lipolysis in adipocytes
pps04930  Type II diabetes mellitus
pps04931  Insulin resistance
pps04932  Non-alcoholic fatty liver disease
pps04940  Type I diabetes mellitus
pps04950  Maturity onset diabetes of the young
pps04960  Aldosterone-regulated sodium reabsorption
pps05010  Alzheimer disease
pps05215  Prostate cancer
pps05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100969387 (INS)
   04014 Ras signaling pathway
    100969387 (INS)
   04015 Rap1 signaling pathway
    100969387 (INS)
   04066 HIF-1 signaling pathway
    100969387 (INS)
   04068 FoxO signaling pathway
    100969387 (INS)
   04072 Phospholipase D signaling pathway
    100969387 (INS)
   04022 cGMP-PKG signaling pathway
    100969387 (INS)
   04151 PI3K-Akt signaling pathway
    100969387 (INS)
   04152 AMPK signaling pathway
    100969387 (INS)
   04150 mTOR signaling pathway
    100969387 (INS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100969387 (INS)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100969387 (INS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100969387 (INS)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100969387 (INS)
   04910 Insulin signaling pathway
    100969387 (INS)
   04923 Regulation of lipolysis in adipocytes
    100969387 (INS)
   04913 Ovarian steroidogenesis
    100969387 (INS)
   04914 Progesterone-mediated oocyte maturation
    100969387 (INS)
   04917 Prolactin signaling pathway
    100969387 (INS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100969387 (INS)
  09149 Aging
   04211 Longevity regulating pathway
    100969387 (INS)
   04213 Longevity regulating pathway - multiple species
    100969387 (INS)
 09160 Human Diseases
  09162 Cancer: specific types
   05215 Prostate cancer
    100969387 (INS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100969387 (INS)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    100969387 (INS)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100969387 (INS)
   04940 Type I diabetes mellitus
    100969387 (INS)
   04950 Maturity onset diabetes of the young
    100969387 (INS)
   04932 Non-alcoholic fatty liver disease
    100969387 (INS)
   04931 Insulin resistance
    100969387 (INS)
SSDB
Motif
Pfam: Insulin Ins_beta
Other DBs
NCBI-GeneID: 100969387
NCBI-ProteinID: XP_008967344
UniProt: A0A2R9C3W5
Position
11
AA seq 110 aa
MALWMRLLPLLALLALWGPDPASAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAED
LQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN
NT seq 333 nt   +upstreamnt  +downstreamnt
atggccctgtggatgcgcctcctgcccctgctggcgctgctggccctctggggacctgac
ccagcctcggcctttgtgaaccaacacctgtgcggctcccacctggtggaagctctctac
ctagtgtgcggggaacgaggcttcttctacacacccaagacccgccgggaggcagaggac
ctgcaggtggggcaggtggagctgggcgggggccctggtgcaggcagcctgcagcccttg
gccctggaggggtccctgcagaagcgtggtatcgtggaacaatgctgtaccagcatctgc
tccctctaccagctggagaactactgcaactag

DBGET integrated database retrieval system