KEGG   Pan paniscus (bonobo): 100969443
Entry
100969443         CDS       T02283                                 

Gene name
B4GALT7
Definition
(RefSeq) beta-1,4-galactosyltransferase 7
  KO
K00733  xylosylprotein 4-beta-galactosyltransferase [EC:2.4.1.133]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00532  Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
pps00534  Glycosaminoglycan biosynthesis - heparan sulfate / heparin
pps01100  Metabolic pathways
Module
pps_M00057  Glycosaminoglycan biosynthesis, linkage tetrasaccharide
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    100969443 (B4GALT7)
   00534 Glycosaminoglycan biosynthesis - heparan sulfate / heparin
    100969443 (B4GALT7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pps01003]
    100969443 (B4GALT7)
Enzymes [BR:pps01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.133  xylosylprotein 4-beta-galactosyltransferase
     100969443 (B4GALT7)
Glycosyltransferases [BR:pps01003]
 Glycan extension
  O-Glycan
   100969443 (B4GALT7)
SSDB
Motif
Pfam: Glyco_transf_7C Glyco_transf_7N
Other DBs
NCBI-GeneID: 100969443
NCBI-ProteinID: XP_003806919
UniProt: A0A2R9CIW6
Position
5
AA seq 327 aa
MFPSRRKAAQLPWEDGRSGLLSGGLPRKCSVFHLFVACLSLGFFSLLWLQLSCSGDVARA
VRGQGQETSGPPRACPPEPPPEHWEEDASWGPHRLAVLVPFRERFEELLVFVPHMRRFLS
RKKIRHHIYVLNQVDHFRFNRAALINVGFLESSNSTDYIAMHDVDLLPLNEELDYGFPEA
GPFHVASPELHPLYHYKTYVGGILLLSKQHYRLCNGMSNRFWGWGREDDEFYRRIKGAGL
QLFRPSGITTGYKTFRHLHDPAWRKRDQKRIAAQKQEQFKVDREGGLNTVKYHVASRTAL
SVGGAPCTVLNIMLDCDKTATPWCTFS
NT seq 984 nt   +upstreamnt  +downstreamnt
atgttcccctcgcggaggaaagcggcgcagctgccctgggaggacggcaggtccgggttg
ctctccggcggcctccctcggaaatgttccgtcttccacctcttcgtggcctgcctctcg
ctgggcttcttctccctactctggctgcagctcagctgctctggggacgtggcccgggca
gtcaggggacaagggcaggagacctcgggccctccccgggcctgccccccagagccgccc
cctgagcactgggaagaagacgcatcctggggcccccaccgcctggcggtgctggtgccc
ttccgcgaacgcttcgaggagctcctggtcttcgtgccccacatgcgccgcttcctgagc
aggaagaagatccggcaccacatctacgtgctcaaccaggtggaccacttcaggttcaac
cgggcggcgctcatcaacgtgggcttcctggagagcagcaacagcacggactacattgcc
atgcacgacgttgacctgctccctctcaacgaggagctggactatggctttcctgaggct
gggcccttccacgtggcctccccggagctccaccctctctaccactacaagacctatgtc
ggcggcatcctgctgctctccaagcagcactaccggctgtgcaatgggatgtccaaccgc
ttctggggctggggccgcgaggacgacgagttctaccggcgcattaagggagctgggctc
cagcttttccgcccctcgggaatcacaactgggtacaagacatttcgccacctgcacgac
ccagcctggcggaagagggaccagaagcgcatcgcagctcaaaaacaggagcagttcaag
gtggacagggagggaggcctgaacactgtgaagtaccatgtggcttcccgcactgccctg
tctgtgggcggggccccctgcactgtcctcaacatcatgttggactgtgacaagaccgcc
acaccctggtgcacattcagctga

DBGET integrated database retrieval system