KEGG   Pan paniscus (bonobo): 100969527
Entry
100969527         CDS       T02283                                 

Gene name
CISH
Definition
(RefSeq) cytokine inducible SH2 containing protein
  KO
K04701  cytokine inducible SH2-containing protein
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04630  JAK-STAT signaling pathway
pps04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100969527 (CISH)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100969527 (CISH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pps04121]
    100969527 (CISH)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:pps04990]
    100969527 (CISH)
Ubiquitin system [BR:pps04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     100969527 (CISH)
Domain-containing proteins not elsewhere classified [BR:pps04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   100969527 (CISH)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 100969527
NCBI-ProteinID: XP_003818850
UniProt: A0A2R9C4W1
Position
3
AA seq 258 aa
MVLCVQGPRPLLAVERTGQRPLWAPSLELPKPVMQPLPAGAFLEEVAEGTPAQTESEPKV
LDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSV
KTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCTADTRSDSPDPAP
TPALPMPKEDAPSDPALPAPPPATAVHLKLVQPFVRRSSARSLQHLCRLVINRLVADVDC
LPLPRRMADYLRQYPFQL
NT seq 777 nt   +upstreamnt  +downstreamnt
atggtcctctgcgttcagggacctcgtcctttgctggctgtggagcggactgggcagcgg
cccctgtgggccccgtccctggaactgcccaagccagtcatgcagcccttgcctgctggg
gccttcctcgaggaggtggcagagggtaccccagcccagacagagagtgagccaaaggtg
ctggacccagaggaggatctgctgtgcatagccaagaccttctcctaccttcgggaatct
ggctggtattggggttccattacggccagcgaggcccgacaacacctgcagaagatgcca
gaaggcacgttcttagtacgtgacagcacgcaccccagctacctgttcacgctgtcagtg
aaaaccactcgtggccccaccaatgtacgcattgagtatgccgactccagcttccgtctg
gactccaactgcttgtccaggccacgcatcctggcctttccggatgtggtcagccttgtg
cagcactatgtggcctcctgcactgctgatacccgaagcgacagccccgatcctgctccc
accccggccctgcctatgcctaaggaggatgcgcctagtgacccagcactgcctgctcct
ccaccagccactgctgtacacctaaaactggtgcagccctttgtacgcagaagcagtgcc
cgcagcctgcaacacctgtgccgccttgtcatcaaccgtctggtggccgacgtggactgc
ctgccactgccccggcgcatggccgactacctccgacagtaccccttccagctctga

DBGET integrated database retrieval system