KEGG   Pan paniscus (bonobo): 100969647
Entry
100969647         CDS       T02283                                 

Gene name
PTPN2
Definition
(RefSeq) protein tyrosine phosphatase, non-receptor type 2
  KO
K18026  tyrosine-protein phosphatase non-receptor type 2 [EC:3.1.3.48]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100969647 (PTPN2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pps01009]
    100969647 (PTPN2)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100969647 (PTPN2)
Protein phosphatases and associated proteins [BR:pps01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    100969647 (PTPN2)
SSDB
Motif
Pfam: Y_phosphatase DSPc CHASE3 UvrA_DNA-bind
Other DBs
NCBI-GeneID: 100969647
NCBI-ProteinID: XP_003817926
Position
18
AA seq 387 aa
MPTTIEREFEELDTQRRWQPLYLEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVK
LQNAENDYINASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRIVEKES
VKCAQYWPTDDQEMLFKETGFSVKLLSEDVKSYYTVHLLQLENINSGETRTISHFHYTTW
PDFGVPESPASFLNFLFKVRESGSLNPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKGD
DINIKQVLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKCIKGDSSIQKRWKELSKEDLSPA
FDHSPNKIITEKYNGNRIGLEEEKLTGDRYTGLSSKMQDTMEENSESALRKRIREDRKAT
TAQKVQQMKQRLNENERKRKRPRLTDT
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgcccaccaccatcgagcgggagttcgaagagttggatactcagcgtcgctggcagccg
ctgtacttggaaattcgaaatgagtcccatgactatcctcatagagtggccaagtttcca
gaaaacagaaatcgaaacagatacagagatgtaagcccatatgatcacagtcgtgttaaa
ctgcaaaatgctgagaatgattatattaatgccagtttagttgacatagaagaggcacaa
aggagttacatcttaacacagggtccacttcctaacacatgctgccatttctggcttatg
gtttggcagcagaagaccaaagcagttgtcatgctgaaccgcattgtggagaaagaatcg
gttaaatgtgcacagtactggccaacagatgaccaagagatgctgtttaaagaaacagga
ttcagtgtgaagctcttgtcagaagatgtgaagtcgtattatacagtacatctactacaa
ttagaaaatatcaatagtggtgaaaccagaacaatatctcactttcattatactacctgg
ccagattttggagtccctgaatcaccagcttcatttctcaatttcttgtttaaagtgaga
gaatctggctccttgaaccctgaccatgggcctgcggtgatccactgtagcgcaggcatt
gggcgctctggcaccttctctctggtagacacttgtcttgttttgatggaaaaaggagat
gatattaacattaaacaagtgttactgaacatgagaaaataccgaatgggtcttattcag
accccagatcaactgagattctcatacatggctataatagaaggagcaaaatgtataaag
ggagattctagtatacagaaacgatggaaagaactttctaaggaagacttatctcctgcc
tttgatcattcaccaaacaaaataataactgaaaaatacaatgggaacagaataggtcta
gaagaagaaaaactgacaggtgaccgatatacaggactttcctctaaaatgcaagataca
atggaggagaacagtgagagtgctctacggaaacgtattcgagaggacagaaaggccacc
acagctcagaaggtgcagcagatgaaacagaggctaaatgagaatgaacgaaaaagaaaa
aggccaagattgacagacacctaa

DBGET integrated database retrieval system