KEGG   Pan paniscus (bonobo): 100970186
Entry
100970186         CDS       T02283                                 

Definition
(RefSeq) putative V-set and immunoglobulin domain-containing-like protein IGHV4OR15-8
  KO
K06856  immunoglobulin heavy chain
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04064  NF-kappa B signaling pathway
pps04072  Phospholipase D signaling pathway
pps04145  Phagosome
pps04151  PI3K-Akt signaling pathway
pps04613  Neutrophil extracellular trap formation
pps04640  Hematopoietic cell lineage
pps04650  Natural killer cell mediated cytotoxicity
pps04662  B cell receptor signaling pathway
pps04664  Fc epsilon RI signaling pathway
pps04666  Fc gamma R-mediated phagocytosis
pps04672  Intestinal immune network for IgA production
pps05135  Yersinia infection
pps05140  Leishmaniasis
pps05143  African trypanosomiasis
pps05146  Amoebiasis
pps05150  Staphylococcus aureus infection
pps05152  Tuberculosis
pps05169  Epstein-Barr virus infection
pps05171  Coronavirus disease - COVID-19
pps05202  Transcriptional misregulation in cancer
pps05310  Asthma
pps05320  Autoimmune thyroid disease
pps05322  Systemic lupus erythematosus
pps05323  Rheumatoid arthritis
pps05330  Allograft rejection
pps05340  Primary immunodeficiency
pps05414  Dilated cardiomyopathy
pps05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100970186
   04020 Calcium signaling pathway
    100970186
   04072 Phospholipase D signaling pathway
    100970186
   04151 PI3K-Akt signaling pathway
    100970186
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100970186
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100970186
   04613 Neutrophil extracellular trap formation
    100970186
   04650 Natural killer cell mediated cytotoxicity
    100970186
   04662 B cell receptor signaling pathway
    100970186
   04664 Fc epsilon RI signaling pathway
    100970186
   04666 Fc gamma R-mediated phagocytosis
    100970186
   04672 Intestinal immune network for IgA production
    100970186
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100970186
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100970186
   05169 Epstein-Barr virus infection
    100970186
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100970186
   05150 Staphylococcus aureus infection
    100970186
   05152 Tuberculosis
    100970186
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100970186
   05140 Leishmaniasis
    100970186
   05143 African trypanosomiasis
    100970186
  09163 Immune disease
   05310 Asthma
    100970186
   05322 Systemic lupus erythematosus
    100970186
   05323 Rheumatoid arthritis
    100970186
   05320 Autoimmune thyroid disease
    100970186
   05330 Allograft rejection
    100970186
   05340 Primary immunodeficiency
    100970186
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100970186
   05416 Viral myocarditis
    100970186
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100970186
Membrane trafficking [BR:pps04131]
 Endocytosis
  Phagocytosis
   Opsonins
    100970186
SSDB
Motif
Pfam: V-set Ig_3
Other DBs
NCBI-GeneID: 100970186
NCBI-ProteinID: XP_003814080
Position
14
AA seq 237 aa
MKHLWFFLLLVAAPRWVLSQVQLQQWGPGLVKPSETLSLTCAVYGGSISSSGYYWSWIRQ
PPGKGLEWIGEINHSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARGT
VRGGECEPRQKPPCREAEERAQVLLSTSRGRAGPTEPEAGSGAGAGRAGLPHQLRALPPR
QHLAVPRAPLSLLSVVPLPHILAAGFNSHWHPFFNKFPQGPFYLLDKQNILRLLTIP
NT seq 714 nt   +upstreamnt  +downstreamnt
atgaaacacctgtggttcttcctcctgctggtggcagctcccagatgggtcctgtcccag
gtgcagctacagcagtggggcccaggactggtgaagccttcggagaccctgtctctcacc
tgcgctgtctatggtggctccatcagcagtagtggttactactggagctggatccggcag
cccccagggaaggggctggagtggattggggaaatcaatcatagtggaagcaccaactac
aacccatccctcaagagtcgagtcaccatctcagtagacacgtccaagaaccagttctcc
ctgaagctgagctctgtgaccgccgcagacacggccgtgtattactgtgcgagaggcacg
gtgaggggaggtgagtgtgagcccagacaaaaacctccctgcagggaggcggaggagcgg
gcgcaggtgctgctcagcaccagcagggggcgcgcggggcccacagagcccgaggccggg
tcaggagcaggtgcagggagggcggggcttcctcatcagctcagggctctccctcctcgc
cagcacctcgctgtccccagggctcctctttctttattatctgtggttccacttcctcac
atccttgctgcaggatttaacagtcactggcacccttttttcaacaaattcccacaaggc
ccattttaccttcttgacaagcaaaatattctaaggcttctcactatcccttga

KEGG   Pan paniscus (bonobo): 100979030
Entry
100979030         CDS       T02283                                 

Definition
(RefSeq) putative V-set and immunoglobulin domain-containing-like protein IGHV1OR21-1
  KO
K06856  immunoglobulin heavy chain
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04064  NF-kappa B signaling pathway
pps04072  Phospholipase D signaling pathway
pps04145  Phagosome
pps04151  PI3K-Akt signaling pathway
pps04613  Neutrophil extracellular trap formation
pps04640  Hematopoietic cell lineage
pps04650  Natural killer cell mediated cytotoxicity
pps04662  B cell receptor signaling pathway
pps04664  Fc epsilon RI signaling pathway
pps04666  Fc gamma R-mediated phagocytosis
pps04672  Intestinal immune network for IgA production
pps05135  Yersinia infection
pps05140  Leishmaniasis
pps05143  African trypanosomiasis
pps05146  Amoebiasis
pps05150  Staphylococcus aureus infection
pps05152  Tuberculosis
pps05169  Epstein-Barr virus infection
pps05171  Coronavirus disease - COVID-19
pps05202  Transcriptional misregulation in cancer
pps05310  Asthma
pps05320  Autoimmune thyroid disease
pps05322  Systemic lupus erythematosus
pps05323  Rheumatoid arthritis
pps05330  Allograft rejection
pps05340  Primary immunodeficiency
pps05414  Dilated cardiomyopathy
pps05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100979030
   04020 Calcium signaling pathway
    100979030
   04072 Phospholipase D signaling pathway
    100979030
   04151 PI3K-Akt signaling pathway
    100979030
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100979030
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100979030
   04613 Neutrophil extracellular trap formation
    100979030
   04650 Natural killer cell mediated cytotoxicity
    100979030
   04662 B cell receptor signaling pathway
    100979030
   04664 Fc epsilon RI signaling pathway
    100979030
   04666 Fc gamma R-mediated phagocytosis
    100979030
   04672 Intestinal immune network for IgA production
    100979030
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100979030
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100979030
   05169 Epstein-Barr virus infection
    100979030
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100979030
   05150 Staphylococcus aureus infection
    100979030
   05152 Tuberculosis
    100979030
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100979030
   05140 Leishmaniasis
    100979030
   05143 African trypanosomiasis
    100979030
  09163 Immune disease
   05310 Asthma
    100979030
   05322 Systemic lupus erythematosus
    100979030
   05323 Rheumatoid arthritis
    100979030
   05320 Autoimmune thyroid disease
    100979030
   05330 Allograft rejection
    100979030
   05340 Primary immunodeficiency
    100979030
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100979030
   05416 Viral myocarditis
    100979030
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100979030
Membrane trafficking [BR:pps04131]
 Endocytosis
  Phagocytosis
   Opsonins
    100979030
SSDB
Motif
Pfam: V-set Ig_3 Sushi
Other DBs
NCBI-GeneID: 100979030
NCBI-ProteinID: XP_003833417
Position
7
AA seq 120 aa
MDWTWRILFLVVIAAGAQSRVQLAQSGAEVKKPGASVKVSCKASGYTFTSYRMHWVCQAH
AQGLEWMGLVCPSDGSTSHAQKFQGRVTITRDTSMSTAYMELSSLRSEDTAMYYCVRDTM
NT seq 363 nt   +upstreamnt  +downstreamnt
atggactggacttggaggatcctgtttttggtggtcatagctgcaggtgcccagtcccgg
gtacagctggcgcagtctggggctgaggtgaagaagcctggggcctcagtgaaggtctcc
tgcaaggcttctggatacaccttcaccagctaccgtatgcactgggtgtgccaggcccat
gcacaagggcttgagtggatgggattggtgtgccctagtgatggcagcacaagccatgca
cagaagttccagggcagagtcaccataaccagggacacatccatgagcacagcctacatg
gagctaagcagcctgagatctgaggacacggccatgtattactgtgtgagagacacaatg
tga

KEGG   Pan paniscus (bonobo): 100983622
Entry
100983622         CDS       T02283                                 

Definition
(RefSeq) Ig heavy chain Mem5-like
  KO
K06856  immunoglobulin heavy chain
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04064  NF-kappa B signaling pathway
pps04072  Phospholipase D signaling pathway
pps04145  Phagosome
pps04151  PI3K-Akt signaling pathway
pps04613  Neutrophil extracellular trap formation
pps04640  Hematopoietic cell lineage
pps04650  Natural killer cell mediated cytotoxicity
pps04662  B cell receptor signaling pathway
pps04664  Fc epsilon RI signaling pathway
pps04666  Fc gamma R-mediated phagocytosis
pps04672  Intestinal immune network for IgA production
pps05135  Yersinia infection
pps05140  Leishmaniasis
pps05143  African trypanosomiasis
pps05146  Amoebiasis
pps05150  Staphylococcus aureus infection
pps05152  Tuberculosis
pps05169  Epstein-Barr virus infection
pps05171  Coronavirus disease - COVID-19
pps05202  Transcriptional misregulation in cancer
pps05310  Asthma
pps05320  Autoimmune thyroid disease
pps05322  Systemic lupus erythematosus
pps05323  Rheumatoid arthritis
pps05330  Allograft rejection
pps05340  Primary immunodeficiency
pps05414  Dilated cardiomyopathy
pps05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100983622
   04020 Calcium signaling pathway
    100983622
   04072 Phospholipase D signaling pathway
    100983622
   04151 PI3K-Akt signaling pathway
    100983622
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100983622
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100983622
   04613 Neutrophil extracellular trap formation
    100983622
   04650 Natural killer cell mediated cytotoxicity
    100983622
   04662 B cell receptor signaling pathway
    100983622
   04664 Fc epsilon RI signaling pathway
    100983622
   04666 Fc gamma R-mediated phagocytosis
    100983622
   04672 Intestinal immune network for IgA production
    100983622
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100983622
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100983622
   05169 Epstein-Barr virus infection
    100983622
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100983622
   05150 Staphylococcus aureus infection
    100983622
   05152 Tuberculosis
    100983622
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100983622
   05140 Leishmaniasis
    100983622
   05143 African trypanosomiasis
    100983622
  09163 Immune disease
   05310 Asthma
    100983622
   05322 Systemic lupus erythematosus
    100983622
   05323 Rheumatoid arthritis
    100983622
   05320 Autoimmune thyroid disease
    100983622
   05330 Allograft rejection
    100983622
   05340 Primary immunodeficiency
    100983622
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100983622
   05416 Viral myocarditis
    100983622
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100983622
Membrane trafficking [BR:pps04131]
 Endocytosis
  Phagocytosis
   Opsonins
    100983622
SSDB
Motif
Pfam: V-set Ig_3 ig DUF6434
Other DBs
NCBI-GeneID: 100983622
NCBI-ProteinID: XP_008965015
Position
Un
AA seq 338 aa
MEFGLSWVFLVAIIKGVQCQVQLVESGGGLVKPGGSLRLSCAASGFTFSNHYMSWIRQAP
GKGLEWVSYISYDSSYINYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARDTV
RGSQCEPRHKPPCRGPLGPPGGDRTLSTGLSPGQVQVPLRAGFLSWPGAASLSNFPRELL
QIYNSVLTFDASKWKTFLSFLFLCFCVQCEVQLVESGGGVVQPGRSLRLSCAASGFTFSN
YAMHWVRQAPGKGLEWVSVISSSGSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDT
ALYYCAKDTMRGSQREPRQKPPAGRQEGSGLQRALKTH
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggagtttgggctgagctgggttttccttgttgctattataaaaggtgtccagtgtcag
gtgcagctggtggagtctgggggaggcttggtcaagcctggagggtccctgagactctcc
tgtgcagcctctggattcaccttcagtaaccactacatgagctggatccgccaggctcca
gggaaggggctggagtgggtttcatacattagttatgatagtagttacataaactacgca
gactctgtgaagggccgattcaccatctccagggacaacgccaagaactcactgtatctg
caaatgaacagcctgagagccgaggacacggctgtgtattactgtgcgagagacacagtg
aggggaagtcagtgtgagcccagacacaaacctccctgcaggggtcccttgggaccacca
gggggcgacaggacactgagcacggggctgtctccagggcaggtgcaggtgccgctgagg
gctggcttcctgtcatggcctggggctgcctcgttgtcaaatttccccagggaacttctc
cagatttacaattctgtactaacatttgatgcctctaagtggaaaacgtttttgtccttt
ttgtttctttgtttttgtgtccagtgtgaggtgcagctggtggagtctgggggaggcgtg
gtacagcctggcaggtccctgagactctcctgtgcagcctctggattcaccttcagtaac
tatgccatgcactgggtccggcaagctccagggaaggggctggagtgggtctcagttatt
agtagtagtggtagttacatatactacgcagactctgtgaagggccgattcaccatctcc
agagacaacgccaagaactccctgtatctgcaaatgaacagtctgagagctgaggacaca
gccttgtattactgtgcaaaagacacaatgaggggaagtcagcgagagcccagacaaaaa
cctcctgcaggaagacaggaggggtctgggctgcagagggcactcaagacacactga

KEGG   Pan paniscus (bonobo): 100989153
Entry
100989153         CDS       T02283                                 

Definition
(RefSeq) putative V-set and immunoglobulin domain-containing-like protein IGHV4OR15-8
  KO
K06856  immunoglobulin heavy chain
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04064  NF-kappa B signaling pathway
pps04072  Phospholipase D signaling pathway
pps04145  Phagosome
pps04151  PI3K-Akt signaling pathway
pps04613  Neutrophil extracellular trap formation
pps04640  Hematopoietic cell lineage
pps04650  Natural killer cell mediated cytotoxicity
pps04662  B cell receptor signaling pathway
pps04664  Fc epsilon RI signaling pathway
pps04666  Fc gamma R-mediated phagocytosis
pps04672  Intestinal immune network for IgA production
pps05135  Yersinia infection
pps05140  Leishmaniasis
pps05143  African trypanosomiasis
pps05146  Amoebiasis
pps05150  Staphylococcus aureus infection
pps05152  Tuberculosis
pps05169  Epstein-Barr virus infection
pps05171  Coronavirus disease - COVID-19
pps05202  Transcriptional misregulation in cancer
pps05310  Asthma
pps05320  Autoimmune thyroid disease
pps05322  Systemic lupus erythematosus
pps05323  Rheumatoid arthritis
pps05330  Allograft rejection
pps05340  Primary immunodeficiency
pps05414  Dilated cardiomyopathy
pps05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100989153
   04020 Calcium signaling pathway
    100989153
   04072 Phospholipase D signaling pathway
    100989153
   04151 PI3K-Akt signaling pathway
    100989153
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100989153
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100989153
   04613 Neutrophil extracellular trap formation
    100989153
   04650 Natural killer cell mediated cytotoxicity
    100989153
   04662 B cell receptor signaling pathway
    100989153
   04664 Fc epsilon RI signaling pathway
    100989153
   04666 Fc gamma R-mediated phagocytosis
    100989153
   04672 Intestinal immune network for IgA production
    100989153
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100989153
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100989153
   05169 Epstein-Barr virus infection
    100989153
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100989153
   05150 Staphylococcus aureus infection
    100989153
   05152 Tuberculosis
    100989153
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100989153
   05140 Leishmaniasis
    100989153
   05143 African trypanosomiasis
    100989153
  09163 Immune disease
   05310 Asthma
    100989153
   05322 Systemic lupus erythematosus
    100989153
   05323 Rheumatoid arthritis
    100989153
   05320 Autoimmune thyroid disease
    100989153
   05330 Allograft rejection
    100989153
   05340 Primary immunodeficiency
    100989153
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100989153
   05416 Viral myocarditis
    100989153
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100989153
Membrane trafficking [BR:pps04131]
 Endocytosis
  Phagocytosis
   Opsonins
    100989153
SSDB
Motif
Pfam: V-set Ig_3 ig Inhibitor_I68 I-set
Other DBs
NCBI-GeneID: 100989153
NCBI-ProteinID: XP_008959224
Position
14
AA seq 159 aa
MKHLWFFLLLVAAPRWVLSQLQLQESGPGLVKPSQTLSLTCAVSGGSISSGSYYWSWIRQ
PPGKGLEWIGNIYXSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARDT
VRGGECEPREKPPCREAEGAGAGAAQDQQGAREATEPEA
NT seq 479 nt   +upstreamnt  +downstreamnt
atgaaacatctgtggttcttccttctcctggtggcagctcccagatgggtcctgtcccag
ctgcagctgcaggagtcgggcccaggactggtgaagccttcacagaccctgtccctcacc
tgcgctgtctctggtggctccatcagcagtggtagttactactggagctggatccggcag
ccaccagggaagggactggagtggattgggaatatctatnacagtgggagcacctactac
aacccgtccctcaagagtcgagtcaccatatcagtagacacgtccaagaaccagttctcc
ctgaagctgagctctgtgaccgccgcagacacggccgtgtattactgtgcgagagacaca
gtgaggggaggtgagtgtgagcccagagaaaaacctccctgcagggaggcggagggggcg
ggcgcaggtgctgctcaggaccaacagggggcgcgcgaggccacagagcccgaggccag

KEGG   Pan paniscus (bonobo): 103785315
Entry
103785315         CDS       T02283                                 

Definition
(RefSeq) putative V-set and immunoglobulin domain-containing-like protein IGHV4OR15-8
  KO
K06856  immunoglobulin heavy chain
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04064  NF-kappa B signaling pathway
pps04072  Phospholipase D signaling pathway
pps04145  Phagosome
pps04151  PI3K-Akt signaling pathway
pps04613  Neutrophil extracellular trap formation
pps04640  Hematopoietic cell lineage
pps04650  Natural killer cell mediated cytotoxicity
pps04662  B cell receptor signaling pathway
pps04664  Fc epsilon RI signaling pathway
pps04666  Fc gamma R-mediated phagocytosis
pps04672  Intestinal immune network for IgA production
pps05135  Yersinia infection
pps05140  Leishmaniasis
pps05143  African trypanosomiasis
pps05146  Amoebiasis
pps05150  Staphylococcus aureus infection
pps05152  Tuberculosis
pps05169  Epstein-Barr virus infection
pps05171  Coronavirus disease - COVID-19
pps05202  Transcriptional misregulation in cancer
pps05310  Asthma
pps05320  Autoimmune thyroid disease
pps05322  Systemic lupus erythematosus
pps05323  Rheumatoid arthritis
pps05330  Allograft rejection
pps05340  Primary immunodeficiency
pps05414  Dilated cardiomyopathy
pps05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    103785315
   04020 Calcium signaling pathway
    103785315
   04072 Phospholipase D signaling pathway
    103785315
   04151 PI3K-Akt signaling pathway
    103785315
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    103785315
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103785315
   04613 Neutrophil extracellular trap formation
    103785315
   04650 Natural killer cell mediated cytotoxicity
    103785315
   04662 B cell receptor signaling pathway
    103785315
   04664 Fc epsilon RI signaling pathway
    103785315
   04666 Fc gamma R-mediated phagocytosis
    103785315
   04672 Intestinal immune network for IgA production
    103785315
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    103785315
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    103785315
   05169 Epstein-Barr virus infection
    103785315
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103785315
   05150 Staphylococcus aureus infection
    103785315
   05152 Tuberculosis
    103785315
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103785315
   05140 Leishmaniasis
    103785315
   05143 African trypanosomiasis
    103785315
  09163 Immune disease
   05310 Asthma
    103785315
   05322 Systemic lupus erythematosus
    103785315
   05323 Rheumatoid arthritis
    103785315
   05320 Autoimmune thyroid disease
    103785315
   05330 Allograft rejection
    103785315
   05340 Primary immunodeficiency
    103785315
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103785315
   05416 Viral myocarditis
    103785315
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    103785315
Membrane trafficking [BR:pps04131]
 Endocytosis
  Phagocytosis
   Opsonins
    103785315
SSDB
Motif
Pfam: V-set Ig_3 I-set
Other DBs
NCBI-GeneID: 103785315
NCBI-ProteinID: XP_008964868
Position
14
AA seq 198 aa
MKHLWFFLLLVAAPRWVLSQVQLQQWGTELLKPSETLSLTCAVYGGSFSGCYWSWIRQPP
GKGLEWIGEINHSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARDTVM
GVYCRKRKHSHLSQSRLCSPEPVHANNCVSRCTLGLMKPSQTLSLTCAISAFSITTSVSF
WSCIHQRPHGRYWSGSGA
NT seq 597 nt   +upstreamnt  +downstreamnt
atgaaacacctgtggttcttcctcctcctggtggcagctcccagatgggtcctgtcccag
gtgcagctacagcagtggggcacagaactgttgaagccttcggagaccctgtccctcacc
tgcgctgtctatggtgggtccttcagtggttgctactggagctggatccgccagccccca
gggaaggggctggagtggattggggaaatcaatcatagtggaagcaccaactacaaccca
tctctcaagagtcgagtcaccatatcagtagacacgtccaagaaccagttctccctgaag
ctgagctctgtgaccgccgcggacacggccgtgtattactgtgcgagagacacagtgatg
ggagtttattgtaggaagaggaaacattctcatttgtcccaaagcagattgtgttctcca
gaacctgtgcatgccaacaactgtgtttctcggtgcactcttggcctgatgaagccctca
cagaccctctccctcacctgtgccatctctgcattctccatcacaaccagtgtttccttc
tggagctgcatccatcagcgcccccatgggaggtactggagtggatcgggtgcatag

KEGG   Pan paniscus (bonobo): 103785316
Entry
103785316         CDS       T02283                                 

Definition
(RefSeq) putative V-set and immunoglobulin domain-containing-like protein IGHV4OR15-8
  KO
K06856  immunoglobulin heavy chain
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04064  NF-kappa B signaling pathway
pps04072  Phospholipase D signaling pathway
pps04145  Phagosome
pps04151  PI3K-Akt signaling pathway
pps04613  Neutrophil extracellular trap formation
pps04640  Hematopoietic cell lineage
pps04650  Natural killer cell mediated cytotoxicity
pps04662  B cell receptor signaling pathway
pps04664  Fc epsilon RI signaling pathway
pps04666  Fc gamma R-mediated phagocytosis
pps04672  Intestinal immune network for IgA production
pps05135  Yersinia infection
pps05140  Leishmaniasis
pps05143  African trypanosomiasis
pps05146  Amoebiasis
pps05150  Staphylococcus aureus infection
pps05152  Tuberculosis
pps05169  Epstein-Barr virus infection
pps05171  Coronavirus disease - COVID-19
pps05202  Transcriptional misregulation in cancer
pps05310  Asthma
pps05320  Autoimmune thyroid disease
pps05322  Systemic lupus erythematosus
pps05323  Rheumatoid arthritis
pps05330  Allograft rejection
pps05340  Primary immunodeficiency
pps05414  Dilated cardiomyopathy
pps05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    103785316
   04020 Calcium signaling pathway
    103785316
   04072 Phospholipase D signaling pathway
    103785316
   04151 PI3K-Akt signaling pathway
    103785316
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    103785316
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103785316
   04613 Neutrophil extracellular trap formation
    103785316
   04650 Natural killer cell mediated cytotoxicity
    103785316
   04662 B cell receptor signaling pathway
    103785316
   04664 Fc epsilon RI signaling pathway
    103785316
   04666 Fc gamma R-mediated phagocytosis
    103785316
   04672 Intestinal immune network for IgA production
    103785316
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    103785316
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    103785316
   05169 Epstein-Barr virus infection
    103785316
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103785316
   05150 Staphylococcus aureus infection
    103785316
   05152 Tuberculosis
    103785316
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103785316
   05140 Leishmaniasis
    103785316
   05143 African trypanosomiasis
    103785316
  09163 Immune disease
   05310 Asthma
    103785316
   05322 Systemic lupus erythematosus
    103785316
   05323 Rheumatoid arthritis
    103785316
   05320 Autoimmune thyroid disease
    103785316
   05330 Allograft rejection
    103785316
   05340 Primary immunodeficiency
    103785316
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103785316
   05416 Viral myocarditis
    103785316
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    103785316
Membrane trafficking [BR:pps04131]
 Endocytosis
  Phagocytosis
   Opsonins
    103785316
SSDB
Motif
Pfam: V-set Ig_3 ig I-set Inhibitor_I68
Other DBs
NCBI-GeneID: 103785316
NCBI-ProteinID: XP_008964869
Position
14
AA seq 214 aa
MKHLWFFLLLVAAPRWVLSQLQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPP
GKGLEWIGNIYYSGSAYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARDTVR
GGECEPREKPPCREAEGAGAGAAQDQQGAREATEPEARSGAGAGRAGLPHQLSALPPRQH
SDVPRAPLSLLSVVLLPHILVADKKGGRQFSVYC
NT seq 645 nt   +upstreamnt  +downstreamnt
atgaaacacctgtggttcttccttctcctggtggcagctcccagatgggtcctgtcccag
ctgcagctgcaggagtcaggcccaggactggtgaagccttcggagaccctgtccctcacc
tgcactgtctctggtggctccatcagtagttactactggagctggatccggcagccacca
gggaagggactggagtggattgggaatatctattacagtgggagcgcctactacaacccg
tccctcaagagtcgagtcaccatatcagtagacacgtccaagaaccagttctccctgaag
ctgagctctgtgaccgccgcagacacggccgtgtattactgtgcgagagacacagtgagg
ggaggtgagtgtgagcccagagaaaaacctccctgcagggaggcggagggggcgggcgca
ggtgctgctcaggaccaacagggggcgcgcgaggccacagagcccgaggccaggtcagga
gcaggtgcagggagggcggggcttcctcatcagctcagtgctctccctcctcgccagcac
tcagatgtccccagggctcctctttctttattatctgtggttctgcttcctcacatcctt
gtggcagacaagaaaggaggaagacaattttctgtttactgttga

DBGET integrated database retrieval system