KEGG   Pan paniscus (bonobo): 100970348Help
Entry
100970348         CDS       T02283                                 

Gene name
LYPLA1
Definition
(RefSeq) lysophospholipase I
  KO
K06128  lysophospholipase I [EC:3.1.1.5]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00564  Glycerophospholipid metabolism
pps05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100970348 (LYPLA1)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    100970348 (LYPLA1)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100970348 (LYPLA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_2 Abhydrolase_3 Hydrolase_4 Cutinase DUF2974 Abhydrolase_1 DLH Lipase_3 Abhydrolase_6 FSH1 Esterase Thioesterase AXE1 DUF2920
Motif
Other DBs
NCBI-GeneID: 100970348
NCBI-ProteinID: XP_003823292
Position
8
AA seq 181 aa AA seqDB search
MGRSLCRPVRPVTLNMNMAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIP
SNRIILGGFSQGGALSLYTALTMQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQC
HGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPI
D
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgggcagaagcctttgcaggcctgttaggcctgttacattaaatatgaacatggctatg
ccttcatggtttgatattattgggctttcaccagattcacaggaggatgaatctgggatt
aaacaggcagcagaaaatataaaagctttgattgatcaagaagtgaagaatggcattcct
tctaacagaattattttgggagggttttctcagggaggagctttatctttatatactgcc
cttaccatgcagcagaaactggcaggtgtcactgcactcagttgctggcttccacttcgg
gcttcctttccacagggtcctatcggtggtgctaatagagatatttctattctccagtgc
catggggattgtgacccgttggttcccctgatgtttggttctcttacggttgaaaaacta
aaaacattggtgaatccagccaatgtgacctttaaaacctatgaaggtatgatgcacagt
tcgtgtcaacaggaaatgatggatgtcaagcaattcattgataaactcctacctccaatt
gattga

DBGET integrated database retrieval system