KEGG   Pan paniscus (bonobo): 100970355
Entry
100970355         CDS       T02283                                 

Gene name
IL21R
Definition
(RefSeq) interleukin 21 receptor
  KO
K05075  interleukin 21 receptor
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04630  JAK-STAT signaling pathway
pps04659  Th17 cell differentiation
pps05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100970355 (IL21R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100970355 (IL21R)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100970355 (IL21R)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    100970355 (IL21R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pps04050]
    100970355 (IL21R)
   04090 CD molecules [BR:pps04090]
    100970355 (IL21R)
Cytokine receptors [BR:pps04050]
 Interleukin receptor families
  IL2 receptor family
   100970355 (IL21R)
CD molecules [BR:pps04090]
 Proteins
  100970355 (IL21R)
SSDB
Motif
Pfam: IL4Ra_N Phage_holin_T
Other DBs
NCBI-GeneID: 100970355
NCBI-ProteinID: XP_003807810
UniProt: A0A2R9C6C4
Position
16
AA seq 538 aa
MPRGWAAPLLLLLLQGGWGCPDLVCYTDYLQTVICILEMWNLHPSTLILTWQDQYEELKD
EATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKP
APPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDS
RSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKEGWNPHLLL
LLLLVIVFIPAFWSLKTHPLWRLWKKIWAVPSPERFFVPLYKGCSGDFKKWVGAPFTGSS
LELGPWSPEVPSTLEVYSCHPPRSPAKRLQLTELQEPAELVESDGVPKPSFWPTAQNSGG
SAYSEERDRPYGLVSIDTVTVLDAEGPCTWPCSCEDDGYPALDLDAGLEPSPGLEDPLLG
AGTTVLSCGCVSAGSPGLGGPLGSLLDRLKPPLADGEDWAGGLPWGGRSPGGVSESEAGS
PLAGLDMDTFDSGFVGSDCSSPVECDFTSPGDEGPPRSYLRQWVVIPPPLSSPGPQAS
NT seq 1617 nt   +upstreamnt  +downstreamnt
atgccgcgtggctgggccgcccccttgctcctgctgctgctccagggaggctggggctgc
cccgacctcgtctgctacaccgattacctccagacggtcatttgcatcctggagatgtgg
aacctccaccccagcacgctcatccttacctggcaagaccagtatgaagagctgaaggac
gaggccacctcctgcagcctccacaggtcggcccacaatgccacgcatgccacctacacc
tgccacatggatgtattccacttcatggccgacgacattttcagtgtcaacatcacagac
cagtctggcaactactcccaggagtgtggcagctttctcctggctgagagcatcaagccg
gctccccctttcaacgtgactgtgaccttctcaggacagtataatatctcctggcgctca
gattacgaagaccctgccttctacatgctgaagggcaagcttcagtatgagctgcagtac
aggaaccggggagacccctgggctgtgagtccgaggagaaagctgatctcagtggactca
agaagtgtctccctcctccccctggagttccgcaaagactcgagctatgagctgcaggtg
cgggcagggcccatgcctggctcctcctaccaggggacctggagtgaatggagtgacccg
gtcatctttcagacccagtcagaggagttaaaggaaggctggaaccctcacctgctgctt
ctcctcctgcttgtcatagtcttcattcctgccttctggagcctgaagacccatccattg
tggaggctatggaagaagatatgggccgtccccagccctgagcggttcttcgtgcccctg
tacaagggctgcagcggagacttcaagaaatgggtgggtgcacccttcactggctctagc
ctggagctgggaccctggagcccagaggtgccctccaccctggaggtgtacagctgccac
ccaccacggagcccggccaagaggctgcagctcacggagctacaagaaccagcagagctg
gtggagtctgacggtgtgcccaagcccagcttctggccgacagcccagaactcggggggc
tcagcttacagtgaggagagggaccggccgtacggcctggtgtccattgacacagtgact
gtgctagatgcagaggggccatgcacctggccctgcagctgtgaggatgacggctaccca
gccctggacctggatgctggcctggagcccagcccaggcctagaggacccactcttgggt
gcagggaccacagtcctctcctgtggctgtgtctcagctggcagccctgggctgggaggg
cccctgggaagcctcctggacagactaaagccaccccttgcagatggggaggactgggct
gggggactgccctggggtggccggtcacctggaggggtctcagagagtgaggcaggctca
cccctggctggcctggatatggacacgtttgacagtggctttgtgggctctgactgcagc
agccctgtggagtgtgacttcaccagccccggggatgaaggacccccccggagctacctc
cgccagtgggtggtcattcctccgccactttcgagccctggaccccaggccagctag

DBGET integrated database retrieval system