KEGG   Pan paniscus (bonobo): 100970360
Entry
100970360         CDS       T02283                                 

Gene name
FASLG
Definition
(RefSeq) Fas ligand
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01524  Platinum drug resistance
pps04010  MAPK signaling pathway
pps04014  Ras signaling pathway
pps04060  Cytokine-cytokine receptor interaction
pps04068  FoxO signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04210  Apoptosis
pps04217  Necroptosis
pps04650  Natural killer cell mediated cytotoxicity
pps04722  Neurotrophin signaling pathway
pps04932  Non-alcoholic fatty liver disease
pps04940  Type I diabetes mellitus
pps05022  Pathways of neurodegeneration - multiple diseases
pps05142  Chagas disease
pps05143  African trypanosomiasis
pps05160  Hepatitis C
pps05161  Hepatitis B
pps05162  Measles
pps05163  Human cytomegalovirus infection
pps05164  Influenza A
pps05165  Human papillomavirus infection
pps05168  Herpes simplex virus 1 infection
pps05170  Human immunodeficiency virus 1 infection
pps05200  Pathways in cancer
pps05205  Proteoglycans in cancer
pps05320  Autoimmune thyroid disease
pps05330  Allograft rejection
pps05332  Graft-versus-host disease
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100970360 (FASLG)
   04014 Ras signaling pathway
    100970360 (FASLG)
   04068 FoxO signaling pathway
    100970360 (FASLG)
   04151 PI3K-Akt signaling pathway
    100970360 (FASLG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100970360 (FASLG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100970360 (FASLG)
   04217 Necroptosis
    100970360 (FASLG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100970360 (FASLG)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100970360 (FASLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100970360 (FASLG)
   05205 Proteoglycans in cancer
    100970360 (FASLG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100970360 (FASLG)
   05161 Hepatitis B
    100970360 (FASLG)
   05160 Hepatitis C
    100970360 (FASLG)
   05164 Influenza A
    100970360 (FASLG)
   05162 Measles
    100970360 (FASLG)
   05168 Herpes simplex virus 1 infection
    100970360 (FASLG)
   05163 Human cytomegalovirus infection
    100970360 (FASLG)
   05165 Human papillomavirus infection
    100970360 (FASLG)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100970360 (FASLG)
   05143 African trypanosomiasis
    100970360 (FASLG)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100970360 (FASLG)
   05330 Allograft rejection
    100970360 (FASLG)
   05332 Graft-versus-host disease
    100970360 (FASLG)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    100970360 (FASLG)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100970360 (FASLG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100970360 (FASLG)
   04932 Non-alcoholic fatty liver disease
    100970360 (FASLG)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100970360 (FASLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100970360 (FASLG)
   04052 Cytokines and growth factors [BR:pps04052]
    100970360 (FASLG)
   04090 CD molecules [BR:pps04090]
    100970360 (FASLG)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100970360 (FASLG)
Cytokines and growth factors [BR:pps04052]
 Cytokines
  Tumor necrosis fators
   100970360 (FASLG)
CD molecules [BR:pps04090]
 Proteins
  100970360 (FASLG)
SSDB
Motif
Pfam: TNF GutM
Other DBs
NCBI-GeneID: 100970360
NCBI-ProteinID: XP_003824715
UniProt: A0A2R9A5R2
Position
1
AA seq 280 aa
MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPP
PLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQM
HTASSLEKQIGHPSPPPEKKELRKVAHLTGKPNSRSMPLEWEDTYGIVLLSGVKYKKGGL
VINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWAR
SSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
NT seq 843 nt   +upstreamnt  +downstreamnt
atgcagcagcccttcaattacccatatccccagatctactgggtggacagcagtgccagc
tctccctgggcccctccaggcacagttcttccctgtccaacctctgtgcccagaaggcct
ggtcaaaggaggccaccaccaccaccgccaccgccaccactaccacctccaccgccgcca
ccactgcctccactaccgctgccacccctgaagaagagagggaaccacagcacaggcctg
tgtctccttgtgatgtttttcatggttctggttgccttggtaggattgggcctggggatg
tttcagctcttccacctacagaaggagctggcagaactccgagagtctaccagccagatg
cacacagcatcatctttggagaagcaaataggccaccccagtccaccccctgaaaaaaag
gagctgaggaaagtggcccatttaacaggcaagcccaactcaaggtccatgcctctggaa
tgggaagacacctatggaattgtcctgctttctggagtgaagtataagaagggtggcctt
gtgatcaatgaaactgggctgtactttgtatattccaaagtatacttccggggtcaatct
tgcaacaacctgcccctgagccacaaggtctacatgaggaactctaagtatccccaggat
ctggtgatgatggaggggaagatgatgagctactgcactactgggcagatgtgggcccgc
agcagctacctgggggcagtgttcaatcttaccagtgctgatcatttatatgtcaacgta
tctgagctctctctggtcaattttgaggaatctcagacgtttttcggcttatataagctc
taa

DBGET integrated database retrieval system