KEGG   Pan paniscus (bonobo): 100970371Help
Entry
100970371         CDS       T02283                                 

Gene name
CAMK4
Definition
(RefSeq) calcium/calmodulin dependent protein kinase IV
  KO
K05869  calcium/calmodulin-dependent protein kinase IV [EC:2.7.11.17]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04024  cAMP signaling pathway
pps04211  Longevity regulating pathway
pps04371  Apelin signaling pathway
pps04380  Osteoclast differentiation
pps04720  Long-term potentiation
pps04722  Neurotrophin signaling pathway
pps04725  Cholinergic synapse
pps04921  Oxytocin signaling pathway
pps04925  Aldosterone synthesis and secretion
pps05031  Amphetamine addiction
pps05034  Alcoholism
pps05214  Glioma
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100970371 (CAMK4)
   04020 Calcium signaling pathway
    100970371 (CAMK4)
   04024 cAMP signaling pathway
    100970371 (CAMK4)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100970371 (CAMK4)
   04925 Aldosterone synthesis and secretion
    100970371 (CAMK4)
  09156 Nervous system
   04725 Cholinergic synapse
    100970371 (CAMK4)
   04720 Long-term potentiation
    100970371 (CAMK4)
   04722 Neurotrophin signaling pathway
    100970371 (CAMK4)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100970371 (CAMK4)
  09149 Aging
   04211 Longevity regulating pathway
    100970371 (CAMK4)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    100970371 (CAMK4)
  09165 Substance dependence
   05031 Amphetamine addiction
    100970371 (CAMK4)
   05034 Alcoholism
    100970371 (CAMK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100970371 (CAMK4)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100970371 (CAMK4)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   100970371 (CAMK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like FTA2 Kdo DUF1103 Pkinase_fungal APH YrbL-PhoP_reg
Motif
Other DBs
NCBI-GeneID: 100970371
NCBI-ProteinID: XP_008950349
UniProt: A0A2R9C7Q5
Position
5
AA seq 473 aa AA seqDB search
MLKVTVPSCSASSCSSVTASAAPGTASLVPDYWIDGSNRDALSDFFEVESELGRGATSIV
YRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLEL
VTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAP
LKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEP
FYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWV
TGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHGSIQESHKASRDPS
PIQDGNEDMKAIPEGEKIQGDGAQASFKGAQAELMKVQALEKVKGADINAEEAPKMVPKA
VEDGIKVADLELEEGLAEEKLKTVEEAAAPREGQGSSAVGFEVPQQDVILPEY
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaagtcacggtgccctcctgctccgcctcgtcctgctcttcggtcaccgccagt
gcggccccggggaccgcgagcctcgtcccggattactggatcgacggctccaacagggat
gcgctgagcgatttcttcgaggtggagtcggagctgggacggggtgctacatccattgtg
tacagatgcaaacagaaggggacccagaagccttatgctctcaaagtgttaaagaaaaca
gtggacaaaaaaatcgtaagaactgagataggagttcttcttcgcctctcacatccaaac
attataaaacttaaagagatatttgaaacccctacagaaatcagtctggtcctagaactc
gtcacaggaggagaactgtttgataggattgtggaaaagggatattacagtgagcgagat
gctgcagatgccgttaaacaaatcctggaggcagttgcttatctacatgaaaatgggatt
gtccatcgtgatctcaaaccagagaatcttctttatgcaactccagccccagatgcacca
ctcaaaattgctgattttggactctctaaaattgtggaacatcaagtgctcatgaagaca
gtatgtggaaccccagggtactgcgcacctgaaattcttagaggttgtgcctatggacct
gaggtggacatgtggtctgtaggaataatcacctacatcttactttgtggatttgaacca
ttctatgatgaaagaggcgatcagttcatgttcaggagaattctgaattgtgaatattac
tttatctccccctggtgggatgaagtatctctaaatgccaaggacttggtcagaaaatta
attgttttggatccaaagaaacggctgactacctttcaagctctccagcatccgtgggtc
acaggtaaagcagccaattttgtacacatggataccgctcaaaagaagctccaagaattc
aatgcccggcgtaagcttaaggcagcggtgaaggctgtggtggcctcttcccgcctggga
agtgccagcagcagccatggcagcatccaggagagccacaaggctagccgagacccttct
ccaatccaagacggcaacgaggacatgaaagctattccagaaggagagaaaattcaaggc
gatggggcccaagcctcatttaagggggcacaggctgagctgatgaaggtgcaagcctta
gagaaagttaaaggtgcagatataaatgctgaagaggcccccaaaatggtgcccaaggca
gtggaggatgggataaaggtggctgacctggaactagaggagggcctagcagaggagaag
ctgaagactgtggaggaggcagcagctcccagagaagggcaaggaagctctgctgtgggc
tttgaagttccacagcaagatgtgatcctgccagagtactaa

DBGET integrated database retrieval system