KEGG   Pan paniscus (bonobo): 100970469
Entry
100970469         CDS       T02283                                 

Gene name
NPY1R
Definition
(RefSeq) neuropeptide Y receptor Y1
  KO
K04204  neuropeptide Y receptor type 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04024  cAMP signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100970469 (NPY1R)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100970469 (NPY1R)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100970469 (NPY1R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100970469 (NPY1R)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Peptide
   Neuropeptide Y
    100970469 (NPY1R)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx Git3
Other DBs
NCBI-GeneID: 100970469
NCBI-ProteinID: XP_003822577
UniProt: A0A2R9CMK6
Position
4
AA seq 383 aa
MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLA
LIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQ
CVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMT
DEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKR
RNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNL
LFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVS
KTSLKQASPVAFKKINNDDNEKI
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgaattcaacattattttcccaggttgaaaatcattcagtccactctaatttctcagag
aagaatgcccagcttctggcttttgaaaatgatgattgtcatctgcccttggccatgata
tttaccttagctcttgcttatggagctgtgatcattcttggtgtctctggaaacctggcc
ttgatcataatcatcttgaaacaaaaggagatgagaaatgttaccaacatcctgattgtg
aacctttccttctcagacttgcttgttgccatcatgtgtctcccctttacatttgtctac
acattaatggaccactgggtctttggtgaggcgatgtgtaagttgaatccttttgtgcaa
tgtgtttcaatcactgtgtccattttctctctggttctcattgctgtggaacgacatcag
ctgataatcaaccctcgagggtggagaccaaataatagacatgcttatgtaggtattgct
gtgatttgggtccttgctgtggcttcttctttgcctttcctgatctaccaagtaatgact
gatgagccattccaaaatgtaacacttgatgcgtacaaagacaaatacgtgtgctttgat
caatttccatcggactctcataggttgtcttataccactctcctcttggtgctgcagtat
tttggtccactttgttttatatttatttgctacttcaagatatatatacgcctaaaaagg
agaaacaacatgatggacaagatgagagacaataagtacaggtccagtgaaaccaaaaga
atcaatatcatgctgctctccattgtggtagcgtttgcagtctgctggctccctcttacc
atctttaacactgtgtttgattggaatcatcagatcattgctacctgcaaccacaatctg
ttattcctgctctgccacctcacagcaatgatatccacttgtgtcaaccccatattttat
gggttcctgaacaaaaacttccagagagacttgcagttcttcttcaacttttgtgatttc
cggtctcgggatgatgattatgaaacaatagccatgtccaccatgcacacagatgtttcc
aaaacttctttgaagcaagcaagcccagtcgcatttaaaaaaatcaacaatgatgataat
gaaaaaatctga

DBGET integrated database retrieval system