KEGG   Pan paniscus (bonobo): 100970574
Entry
100970574         CDS       T02283                                 

Gene name
CD4
Definition
(RefSeq) CD4 molecule
  KO
K06454  T-cell surface glycoprotein CD4
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04514  Cell adhesion molecules
pps04612  Antigen processing and presentation
pps04640  Hematopoietic cell lineage
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04660  T cell receptor signaling pathway
pps05135  Yersinia infection
pps05166  Human T-cell leukemia virus 1 infection
pps05170  Human immunodeficiency virus 1 infection
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pps05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100970574 (CD4)
   04514 Cell adhesion molecules
    100970574 (CD4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100970574 (CD4)
   04612 Antigen processing and presentation
    100970574 (CD4)
   04660 T cell receptor signaling pathway
    100970574 (CD4)
   04658 Th1 and Th2 cell differentiation
    100970574 (CD4)
   04659 Th17 cell differentiation
    100970574 (CD4)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100970574 (CD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100970574 (CD4)
   05170 Human immunodeficiency virus 1 infection
    100970574 (CD4)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100970574 (CD4)
  09163 Immune disease
   05340 Primary immunodeficiency
    100970574 (CD4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pps04090]
    100970574 (CD4)
CD molecules [BR:pps04090]
 Proteins
  100970574 (CD4)
SSDB
Motif
Pfam: CD4-extracel C2-set ig V-set I-set Ig_3 Ig_2 Receptor_2B4 Tcell_CD4_C Ig_6 UPF0560 Herpes_gE
Other DBs
NCBI-GeneID: 100970574
NCBI-ProteinID: XP_008971926
UniProt: A0A2R9B4G7
Position
12
AA seq 458 aa
MNRGVPFRHLLLVLQLALLPAATQGKKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQTK
ILGNQGSFLTKGPSKLNDRVDSRRSLWDQGNFPLIIKNLKIEDSDTYICEVGDQKEEVQL
LVFGLTANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSG
TWTCTVLQNQKKVEFKIDIVVLAFQKASSIVYKKEGEQVEFSFPLAFTVEKLTGSGELWW
QAERASSSKSWITFDLKNKEVSVKRVTQDPKLQMGKKLPLHLTLPQALPQYAGSGNLTLA
LEAKTGKLHQEVNLVVMRATQLQKNLTCEVWGPTSPKLMLSLKLENKEAKVSKREKAVWV
LNPEAGMWQCLLSDSGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCV
RCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgaaccggggagtcccttttaggcacttgcttctggtgctgcaactggcgctcctccca
gcagccactcagggaaagaaagtggtgctgggcaagaaaggggacacagtggaactgacc
tgtacagcttcccagaagaagagcatacaattccactggaaaaactccaaccagacaaag
attctgggaaatcagggctccttcttaactaaaggtccatccaagctgaatgatcgcgtt
gactcaagaagaagcctttgggaccaaggaaactttcccctgatcatcaagaatcttaag
atagaagactcagatacttacatctgtgaagtgggggaccagaaggaggaggtgcaattg
ctagtgttcggattgactgccaactctgacacccacctgcttcaggggcagagcctgacc
ctgaccttggagagcccccctggtagtagcccctcagtgcaatgtaggagtccaaggggt
aaaaacatacagggggggaagaccctctccgtgtctcagctggagctccaggatagtggc
acctggacatgcactgtcttgcagaaccagaagaaagtggagttcaaaatagacatcgtg
gtgctagctttccagaaggcctccagcatagtctataagaaagagggggaacaggtggag
ttctccttcccactcgcctttacagttgaaaagctgacgggcagtggcgagctgtggtgg
caggcggagagggcttcctcctccaagtcttggatcacctttgacctgaagaacaaggaa
gtgtctgtaaaacgggttacccaggaccctaagctccagatgggcaagaagctcccgctc
cacctcaccctgccccaggccttgcctcagtatgctggctctggaaacctcaccctggcc
cttgaagcgaaaacaggaaagttgcatcaggaagtgaacctcgtggtgatgagagccact
cagctccagaaaaatttgacctgtgaggtgtggggacccacctcccctaagctgatgctg
agcttgaaactggagaacaaggaggcaaaggtctcgaagcgggagaaggcggtgtgggtg
ctgaaccctgaggcggggatgtggcagtgtctgctgagtgactcgggacaggtcctgctg
gaatccaacatcaaggttctgcccacatggtccaccccggtgcagccaatggccctgatt
gtgctggggggcgtcgccggcctcctgcttttcattgggctaggcatcttcttctgtgtc
aggtgccggcaccgaaggcgccaagcagagcggatgtctcagatcaagagactcctcagt
gagaagaagacctgccagtgccctcaccggtttcagaagacatgtagccccatttga

DBGET integrated database retrieval system