KEGG   Pan paniscus (bonobo): 100970951
Entry
100970951         CDS       T02283                                 

Gene name
TNKS1BP1
Definition
(RefSeq) tankyrase 1 binding protein 1
Organism
pps  Pan paniscus (bonobo)
SSDB
Motif
Pfam: Tankyrase_bdg_C
Other DBs
NCBI-GeneID: 100970951
NCBI-ProteinID: XP_003826486
UniProt: A0A2R9BVZ9
Position
3
AA seq 1727 aa
MKVSTLRESSAMASPLPREMEEELVPTGPEPGDTRAKPPVKPKPRALPAKPALPAKPSLL
VPVGPRPPRGPLAELPSARKMNMLAGPQPYGGSKRPLPFAPRPVVEASTGGEATQETGKE
EAGKEEPPPLTPPARCAAPGGVRKAPAPFRPASERFAATTVEEILAKMEQPRKEVPASPD
RLWGSRLTFNHDGSSRYGPRTYGTTTAPRDEDGSTLSRGWSQEGPVKSPAECREEHSKTP
EERSLPSDLAFNGDLAKAASSELPADISKPWIPSSPAPSSENGGPASPALPAEASGSGPG
SPHLHLPDKTSPCHSQLLEAQTPEASQASPCPPVTPSAPSAALPDEGSRHTPSPGLPAEG
APEAPRPSSPPPEVLEPHSLDQPPATSPRPLIEVGELLDLTRTFPSGGEEEAKGDAHLRP
TSLVQRRFSEGVLQSPSQDQEKLGGSLAALPQGQGSQLALDRPFGAESNWSLSQSFEWTF
PTRPSGLGVWRLDSPPPSPITEASEAAEAAEAGNLAVSSREEGVSQQGQGAGSAPSGSGS
SWVQGDDPSMSLTQKGDGESQPQFPALPLEPLPTTEGTPGLPLQQAEERYESQEPLAGQE
SPLPLATREAALPILEPVLGQEQPAAPDQPCVLFADAPEPGQALPVEEEAVTLARAETTQ
PRTEAQDLCRASPEPPGPESSSRWLDDLLASPPPSGGGARRGAGSELKDTQSPSTCSEGL
LGWSQKDLQSEFGITGDPQPSSFSPSSWCQGASQDYGLGGASPRGDPGLGERDWTSKYGQ
GAGEGSTREWASRCGIGQEEMEASSSQDQSKVSAPGVLTAQDRVVGKPAQLGTQRSQEAD
VQDWEFRKRDSQGTYSSRDAELQDQEFGKRDSLGTYSSRDVSLGDWEFGKRDSLGAYASQ
DANEQGQDLGKRDHHGRYSSPDADEQDWEFQKRDVSLGTYGSAEPQEQEFGKSAWIRDYS
SGGSSRTLDAQDRSFGTRPLSSGFSPEEAQQQDEEFEKKIPSVEDSLGEGSRDAGRPGER
GSGGLFSPSTAHVLDGALGQRDQSSWQNSDASQEVGGHQERQQAGAQGPGNADLEDGEMG
KRGWVGEFSLSVGPRREAAFSPGQQDWSRDFCIEASERSYQFGIIGNDRVSGAGFSPSSK
MEGGHFVPPGKTTAGSVDWTDQLGLRNLEVSSCVGSGGSSEARESAVGQMGWSGGLSLRD
MNLAGCLESGGSEEPGGIGVGEKDWTSDVNVKSKDLAEVGEGGGHSQARESGVGQTDWSG
VEAGQFLKSRERGVGQADWTPDLGLRNMAPGAVCSPGEPKELGVGQMDWGNNLGLRDLEV
TCDPESGGSQGLRGCGVGQMDWTQDLAPRNVELFGAPSEAREHGVGGVSQCPEPGLRHNG
SLSPGLEARDPLEARELGVGETSGPETQGEDYSSSSLEPHPADPGMETGEALSFGASPGR
CPARPPPSGSQGLLEEMLAASSSKAVARRESAASGLGGLLEEEGAGAGAAQEEVLEPGRD
SPPSWRPQPDGEASQTEDVDGTWGSSAARWSDQEPAQTSRRPSQGPPARSPSQDFSFIED
TEILDSAMYRSRANLGRKRGHRAPAIRPGGTLGLSEAADSDARLFQDSTEPRASRVPSSD
EEVVEEPQSRRTRMSLGTKGLKVNLFPGLSPSALKAKLRPRNRSAEEGELAESKSSQKES
AVQRSKSFKVPGLGKPLTLPPKPEKSSGSEGSSPNWLQALKLKKKKV
NT seq 5184 nt   +upstreamnt  +downstreamnt
atgaaagtgtctactctcagggaaagctcagccatggcttccccactgccccgggagatg
gaggaggagctggtgcctactggccctgagccaggtgacactcgggccaaaccccctgtc
aagcccaaaccccgggccctgcctgccaagccagccctgcctgccaaacccagcctgctg
gtgcctgttgggcctcggcctccccggggtcccctggctgagttgccttctgccaggaag
atgaacatgctggcaggaccccagccctatggtggcagcaagcgcccccttccctttgca
ccaaggcctgtggttgaggcctccactggaggagaagccacccaagagactgggaaagag
gaggctgggaaagaggagccaccccctttgacacccccagctcgatgtgcagccccaggg
ggcgtacggaaggcccctgcccctttccgcccagcctcagagcgcttcgcggccaccacg
gtggaagagatcctggccaagatggagcagcctcggaaggaggtccctgccagccctgac
cgcctgtggggttcccgcctcacctttaaccacgatggcagctcgcgatatggccccagg
acctatggcacgaccactgctcccagggatgaggatggcagcaccctctccaggggatgg
tcccaggaggggccagtaaagtctccagcagagtgccgggaagagcacagcaagacccct
gaggagaggagccttccttccgacctggccttcaacggggacctggctaaggcagccagc
tcggagctacctgctgatatttccaagccctggattccctcaagtccagccccctcctca
gagaatggaggccctgccagcccagccctccccgcagaagcctcaggctcaggccctggc
tctccccatcttcacctgcctgataagacttctccctgccactcgcagcttctggaagcc
cagactcctgaagcttcccaggcttctccctgcccccctgtgactccatcagctccaagt
gcagccctgcctgatgagggctcccgccacacccccagcccggggctccctgccgagggg
gctccagaggcccccagacccagcagccctccccctgaggtcttggagccccacagcctg
gatcagccccctgccacctcaccccggcccctgatcgaggtgggtgagttgctggatctc
actcggacgtttccatctggcggggaggaggaggccaagggtgacgcacacctccgcccc
accagcctggttcagcgccgattctctgaaggtgtgctccagtcacccagtcaggaccag
gagaagctggggggctcgctggctgccctgccccaaggccaggggagccagttggccctg
gatcgtccctttggggcagagtccaactggagcttatcacagtccttcgaatggaccttc
cccacgcggccctcgggtctgggcgtgtggcggctggactccccgcctccatcccccatc
actgaagccagtgaggccgccgaggctgctgaggctggcaacttggccgtttccagcagg
gaagaaggagtgtctcagcaggggcaaggggctgggtcagctccaagtgggtcaggaagt
tcctgggtgcagggggatgatccaagcatgtccctcacccagaagggcgatggggagagt
caacctcaattcccagctcttccccttgagcccctgcctacaactgagggcacacctgga
ttacctttgcagcaggcagaggagagatacgagtcgcaggagcccttggctggacaggag
tcccctctccccctggctaccagggaggcagccttgcccatcctggagccagtcctgggg
caggagcagccagcagcccctgaccagccctgtgttctctttgctgatgcccctgagcct
ggacaggcactgcctgttgaggaggaggccgtgaccctagcccgggctgagaccacccaa
cccaggacagaggctcaagacttgtgtagggcatcccctgagcctccaggccctgaaagc
agctcccgctggctggacgacctcctggcttcaccaccacccagtggtggcggtgcaagg
cggggagctggatctgagctgaaggacacacagtccccaagtacctgctctgagggactc
cttggctggtcccagaaagatctgcagagtgaatttgggatcacaggagacccacagccc
agcagtttcagtccttccagctggtgtcaaggtgcttctcaggactatggccttgggggt
gcaagccctagaggagacccaggtctcggagagagggactggaccagcaagtatgggcaa
ggagcaggggaagggagcaccagggagtgggccagcaggtgtggcatcggccaggaggag
atggaggccagcagcagccaagatcagagtaaagtgtctgccccaggggtgctcacagcc
caggaccgggtagttggaaagccagcccagcttggcactcagcggagccaggaggcagat
gttcaggactgggagttcagaaagagggattcccagggcacttactccagccgggatgca
gaactccaggaccaggaattcggaaagagagattcactgggtacctacagtagtcgagat
gtaagccttggggactgggaatttgggaagagagattctctgggtgcttatgccagccaa
gatgccaacgagcagggccaagatttggggaagagggaccaccatggtaggtacagcagc
ccggatgccgatgagcaggactgggagtttcagaagagagatgtgtcactcggcacctat
ggcagcgcggagccacaggaacaggagtttgggaagagcgcttggataagggactacagc
agtggtggcagctccaggacccttgacgcccaggacagaagctttggaacgagacccctg
agctctgggttcagccccgaggaagcccagcaacaggatgaggaatttgagaagaagatt
ccaagtgtggaagacagccttggagagggcagcagggatgctggccggccaggagagaga
ggatccgggggcttgttcagtcctagcactgcccacgtgctggatggggcactcgggcag
agagaccagagcagctggcaaaacagtgatgctagccaggaggtgggagggcatcaggag
agacagcaggcaggggctcagggccctggcaatgctgacctggaagatggggagatggga
aagcgaggctgggtcggtgagtttagcctcagtgttggcccccggcgagaggcagcattt
agcccagggcagcaggactggagccgggacttctgcatcgaggccagtgagaggagctat
cagtttggcatcattggcaacgacagagtgagtggtgctggctttagcccttctagcaag
atggaaggtggtcactttgtgcctcctgggaagaccacagctggctcggtggactggact
gaccagctgggtctcaggaacttggaagtgtccagctgtgtgggttctgggggctcgagc
gaggccagggagagtgccgtgggacagatgggctggtcaggtggcctgagcttgagagac
atgaacctggccggctgtttggaaagtggagggtctgaagagccggggggaatcggagtt
ggggagaaggactggacttctgatgttaatgtgaagagcaaagatttggctgaggtcggg
gagggaggaggccacagccaggccagagagagtggcgtggggcagactgactggtcaggt
gtggaggccggacagttccttaaatcaagggagcgtggagttggacaggcagactggaca
cctgaccttgggctgagaaacatggccccaggggcagtctgcagtcctggagagcccaaa
gagcttggggtgggccagatggactggggtaacaatctgggcctgagggatttggaagtg
acctgtgacccagagtctggaggttctcaggggctacggggatgtggagtggggcagatg
gactggacccaggacttggcaccccggaatgtggagctctttggggctccaagtgaagcc
agggagcatggggtgggcggggtgagccagtgcccagagcccggcctgaggcacaatggc
agcttgtctcctggcctggaggccagagaccccttggaggccagggagctgggggttggt
gagacaagtgggccagagacccagggtgaagattactcctcgtcttccttggagccacac
cctgcagaccctggaatggagacaggagaagccctcagcttcggagccagccctggcagg
tgcccggcccgccccccaccctccggctcccagggcctgctggaggagatgttggcagcc
agcagctccaaggcggtggctcggagggagtcagcggcctcgggccttgggggcctgttg
gaggaggaaggagccggggcaggtgctgcccaagaggaggtgctggagcctggcagggac
tctccaccctcctggaggccccagcctgatggtgaggccagccagacagaagacgtggat
ggcacctggggctcttcagcagccaggtggagcgatcaggagccagcacagacttctcgg
cgaccctcccaaggccctcctgccagatcccccagtcaggacttctccttcattgaggac
accgagatcctcgacagtgccatgtatcggagccgtgccaacttggggcgcaagcgtggg
caccgggccccggccattcggcctgggggtaccttgggcctgtcggaggcagcagactcg
gatgcacgcctgttccaggactctacagagccacgggcatctcgggtgccatcttcagat
gaagaggtagtggaggaacctcagagccgccggacacggatgtcgttgggcaccaagggg
ctgaaagtcaacctctttcctggcctgagcccctcagccctgaaggccaagctgcgcccc
cggaatcgctcagctgaggagggagagctggctgagagcaagtcgagccagaaggagtcc
gcggtccagcgttcgaaatccttcaaggtcccaggactgggaaagcccctcacgttacct
cccaagccagagaaatcctcagggtcagaaggatcgtcgcccaactggcttcaagccctg
aaactgaagaagaagaaggtctga

DBGET integrated database retrieval system