KEGG   Pan paniscus (bonobo): 100971149
Entry
100971149         CDS       T02283                                 

Gene name
GABRQ
Definition
(RefSeq) gamma-aminobutyric acid type A receptor theta subunit
  KO
K05192  gamma-aminobutyric acid receptor subunit theta
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04080  Neuroactive ligand-receptor interaction
pps04723  Retrograde endocannabinoid signaling
pps04727  GABAergic synapse
pps05032  Morphine addiction
pps05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100971149 (GABRQ)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100971149 (GABRQ)
   04723 Retrograde endocannabinoid signaling
    100971149 (GABRQ)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100971149 (GABRQ)
   05033 Nicotine addiction
    100971149 (GABRQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pps04040]
    100971149 (GABRQ)
Ion channels [BR:pps04040]
 Ligand-gated channels
  GABA-A
   100971149 (GABRQ)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 100971149
NCBI-ProteinID: XP_003804564
UniProt: A0A2R9ALH2
Position
X
AA seq 632 aa
MGIRGMLRAAVILLLIRTWLAEGNYPSPIPKFHFEFSSAVPEVVLNLFNCKNCANEAVVQ
KILDRVLSRYDVRLRPNFGGAPVPVRISIYVTSIEQISEMNMDYTITMFFHQTWKDSRLA
YYETTLNLTLDYRMHEKLWVPDCYFLNSKDAFVHDVTVENRVFQLHPDGTVRYGIRLTTT
AACSLDLHKFPMDKQACNLVVESYGYTVEDIILFWDDNGNAIHMTEELHIPQFTFLGRTI
TSKEVYFYTGSYIRLILKFQVQREVNSYLVQVYWPTVLTTITSWISFWMNYDSSAARVTI
GLTSMLILTTIDSHLRDKLPNISCIKAIDIYILVCLFFVFLSLLEYVYINYLFYSRGPRR
QPRRRRRPRRVIAHYRYQQVVVGNVQDGLINVEDGVSSLPITPAQAPLASPESLGSLTST
SEQAQLATSESLSPLTSLSGQAPLATGESLSDLPSTSEQARHSYGVRFNGFQADDSIIPT
EIRNRVEAHGHGVTHDHEDSNESLSSDERHGHGPSGKPMLHHGEKGVQEAGWDLDDNNDK
SDCLAIKEQFKCDTNSTWGLNDDGLMAHGQEKDSSSESEDSCPPSPGCSFTEGFSFDLFN
PDYVPKVDKWSRFLFPLAFGLFNIVYWVYHMY
NT seq 1899 nt   +upstreamnt  +downstreamnt
atgggcatccgaggcatgctgcgagccgcagtgatcctgctgctcatcaggacctggctc
gcggagggcaactaccccagtcccatcccgaaattccacttcgagttctcctctgctgtg
cccgaagtcgtcctgaacctcttcaactgcaaaaattgtgcaaatgaagctgtggttcaa
aagattttggacagggtgctgtcaagatacgatgtccgcctgagaccgaattttggaggt
gcccctgtgcctgtgagaatatctatttatgtcacgagcattgaacagatctcagaaatg
aatatggactacacgatcacgatgttttttcatcagacttggaaagattcacgcttagca
tactatgagaccaccctgaacttgaccctggactatcggatgcatgagaagttgtgggtc
cctgactgctactttctgaacagcaaggatgctttcgtgcatgatgtgactgtggagaat
cgcgtgtttcagcttcacccagatggaacggtgcggtacggcatccgactcaccactaca
gcagcttgttccctggatctgcataaattccctatggacaagcaggcctgcaacctggtg
gtagagagctatggttacacggttgaagacatcatattattctgggatgacaatgggaac
gccatccacatgactgaggagctgcatatccctcagttcactttcctgggaaggacgatt
actagcaaggaggtgtatttctacacaggttcctacatacgcctgatactgaagttccag
gttcagagggaagttaacagctaccttgtgcaagtctactggcctactgtcctcaccact
attacctcttggatatcgttttggatgaactatgattcctctgcagccagggtgacaatt
ggcttaacttcaatgctcatcctgaccaccatcgactcacatctgcgggataagctcccc
aacatttcctgtatcaaggccattgatatctatatcctcgtgtgcttgttctttgtgttc
ctgtccttgctggagtatgtctacatcaactatcttttctacagtcgaggacctcggcgc
cagcctaggcgacgcaggagaccccgaagagtcattgcccactaccgctaccagcaagtg
gtggtaggaaacgtgcaggatggcctgattaacgtggaagacggagtcagctctctcccc
atcaccccagcgcaggcccccctggcaagcccggaaagcctcggttctttgacgtccacc
tccgagcaggcccagctggccacctcggaaagcctcagcccactcacttctctctcaggc
caggcccccctggccactggagaaagcctgagcgatctcccctccacctcagagcaggcc
cggcacagctatggtgttcgctttaatggtttccaggctgatgacagtattattcctacc
gaaatccgcaaccgtgtcgaagcccatggccatggtgttacccatgaccatgaagattcc
aatgagagcttgagctcggatgagcgccatggccatggccccagtgggaagcccatgctt
caccatggcgagaagggtgtgcaagaagcaggctgggaccttgatgacaacaatgacaag
agcgactgccttgccattaaggagcaattcaagtgtgatactaacagtacctggggcctt
aatgatgatgggctcatggcccatggccaagagaaggacagtagctcagagtctgaggat
agttgccccccaagccctgggtgctccttcactgaagggttctccttcgatctctttaat
cctgactacgtcccaaaggtcgacaagtggtcccggttcctcttccctctggcctttggg
ttgttcaacattgtttactgggtataccatatgtattag

DBGET integrated database retrieval system