KEGG   Pan paniscus (bonobo): 100971194
Entry
100971194         CDS       T02283                                 

Gene name
GATA3
Definition
(RefSeq) GATA binding protein 3
  KO
K17895  GATA-binding protein 3
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04928  Parathyroid hormone synthesis, secretion and action
pps05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pps00001]
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100971194 (GATA3)
   04659 Th17 cell differentiation
    100971194 (GATA3)
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100971194 (GATA3)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    100971194 (GATA3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pps03000]
    100971194 (GATA3)
Transcription factors [BR:pps03000]
 Eukaryotic type
  Zinc finger
   Cys4 GATA-factors
    100971194 (GATA3)
SSDB
Motif
Pfam: GATA TF_Zn_Ribbon DZR_2 ArfGap Prim_Zn_Ribbon
Other DBs
NCBI-GeneID: 100971194
NCBI-ProteinID: XP_003827854
UniProt: A0A2R8ZRJ9
Position
10
AA seq 444 aa
MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSYMDAAQYPLPEEVDVLFNIDGQGNHV
PPYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKT
SIHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDE
KECLKYQVPLPDSMKLESSHSRGSMTALGGASSSAHHPITTYPPYVPEYSSGLFPPSSLL
GGSPTGFGCKSRPKARSSTEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRP
LIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKE
GIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTP
TPMHPPSSLSFGPHHPSSMVTAMG
NT seq 1335 nt   +upstreamnt  +downstreamnt
atggaggtgacggcggaccagccgcgctgggtgagccaccaccaccccgccgtgctcaac
gggcagcacccggacacgcaccacccgggcctcagccactcctacatggacgcggcgcag
tacccgctgccggaggaggtggatgtgctttttaacatcgacggtcaaggcaaccacgtc
ccgccctactacggaaactcggtcagggccacggtgcagaggtaccctccgacccaccac
gggagccaggtgtgccgcccgcctctgcttcatggatccctgccctggctggacggcggc
aaagccctgggcagccaccacaccgcctccccctggaatctcagccccttctccaagacg
tccatccaccacggctccccggggcccctctccgtctaccccccggcctcgtcctcctcc
ttgtcggggggccacgccagcccgcacctcttcaccttcccgcccaccccgccgaaggac
gtctccccggacccatcgctgtccaccccaggctcggccggctcggcccggcaggacgag
aaagagtgcctcaagtaccaggtgccgctgcccgacagcatgaagctggagtcgtcccac
tcccgtggcagcatgaccgccctgggtggggcctcctcgtcggcccaccaccccatcacc
acctacccgccctacgtgcccgagtacagctccggactcttcccccccagcagcctgctg
ggcggctcccccaccggcttcggatgcaagtccaggcccaaggcccggtccagcacagaa
ggcagggagtgtgtgaactgtggggcaacctcgaccccactgtggcggcgagatggcacg
ggacactacctgtgcaacgcctgcgggctctaccacaaaatgaacggacagaaccggccc
ctcattaagcccaagcgaaggctgtctgcagccaggagagcagggacgtcctgtgcgaac
tgtcagaccaccacaaccacactctggaggaggaatgccaatggggaccctgtctgcaat
gcctgtgggctctactacaagcttcacaatattaacagacccctgactatgaagaaggaa
ggcatccagaccagaaaccgaaaaatgtctagcaaatccaaaaagtgcaaaaaagtgcat
gactcactggaggacttccccaagaacagctcgtttaacccggccgccctctccagacac
atgtcctccctgagccacatctcgcccttcagccactccagccacatgctgaccacgccc
acgccgatgcacccgccatccagcctgtcctttggaccgcaccacccctccagcatggtc
accgccatgggttag

DBGET integrated database retrieval system