KEGG   Pan paniscus (bonobo): 100971365Help
Entry
100971365         CDS       T02283                                 

Gene name
FBXL7
Definition
(RefSeq) F-box and leucine rich repeat protein 7
  KO
K10273  F-box and leucine-rich repeat protein 7
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pps04121]
    100971365 (FBXL7)
Ubiquitin system [BR:pps04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     100971365 (FBXL7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_6 F-box-like LRR_4 F-box PTE
Motif
Other DBs
NCBI-GeneID: 100971365
NCBI-ProteinID: XP_003821989
UniProt: A0A2R8ZQ64
Position
5
AA seq 491 aa AA seqDB search
MGANNGKQYGSEGKGSSSISSDVSSSTDHTPTKAQKNVATSEDSDLSMRTLSTPSPALIC
PPNLPGFQNGRGSSTSSSSITGETVAMVHSPPPTRLTHPLIRLASRPQKEQASIDRLPDH
SMVQIFSFLPTNQLCRCARVCRRWYNLAWDPRLWRTIRLTGETINVDRALKVLTRRLCQD
TPNVCLMLETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNL
EHLDVSGCSKVTCISLTREASIKLSPLHGKQISIRYLDMTDCFVLEDEGLHTIAAHCTQL
THLYLRRCVRLTDEGLRYLVIYCASIKELSVSDCRFVSDFGLREIAKLESRLRYLSIAHC
GRVTDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIGKCPLVSDTGL
ECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDCEVSVEALRFVKRHCKR
CVIEHTNPAFF
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcgaacaatggcaaacagtacggcagtgagggcaaaggcagctcgagcatctca
tctgacgtgagttcaagtacagatcacacgcccactaaagcccagaagaatgtggctacc
agcgaagactccgacctgagcatgcgcacactgagcacgcccagcccagccctgatatgt
ccaccgaatctcccaggatttcagaatggaaggggctcgtccacctcctcgtcctccatc
accggggagacggtggccatggtgcactccccgcccccgacccgcctcacacacccgctc
atccggctcgcctccagaccccagaaggagcaggccagcatagaccggctcccggaccac
tccatggtgcagatcttctccttcctgcccaccaaccagctgtgccgctgcgcgcgagtg
tgccgccgctggtacaacctggcctgggacccgcggctctggaggactatccgcctgacg
ggcgagaccatcaacgtggaccgcgccctcaaggtgctgacccgcagactctgccaggac
acccccaacgtgtgtctcatgctggaaaccgtaactgtcagtggctgcaggcggctcaca
gaccgagggctgtacaccatcgcccagtgctgccccgaactgaggcgactggaagtctca
ggctgttacaatatctccaacgaggccgtctttgacgtggtgtccctctgccctaatctg
gagcacctggatgtgtcaggatgctccaaagtgacctgcatcagcttgacccgggaggcc
tccattaaactgtcccccttgcatggcaaacagatttccattcgctacctggacatgacg
gactgcttcgtgctggaggacgaaggcctgcacaccatcgcggcgcactgcacgcagctc
acccacctctacctgcgccgctgcgtccgcctgaccgacgaaggcctgcgctacctggtg
atctactgcgcctccatcaaggagctgagcgtcagcgactgccgcttcgtcagcgacttc
ggcctgcgggagatcgccaagctggagtcccgcctgcggtacctgagcatcgcgcactgc
ggccgggtcaccgacgtgggcatccgctacgtggccaagtactgcagcaagctgcgctac
ctcaacgcgaggggctgcgagggcatcacggaccacggtgtggagtacctcgccaagaac
tgcaccaaactcaaatccctggatatcggcaaatgccctttggtatccgacacgggcctg
gagtgcctggccctgaactgcttcaacctcaagcggctcagcctcaagtcctgcgagagc
atcaccggccagggcttgcagatcgtggccgccaactgctttgacctccagacgctgaat
gtccaggactgcgaggtctccgtggaggccctgcgctttgtcaaacgccactgcaagcgc
tgcgtcatcgagcacaccaacccggctttcttctga

DBGET integrated database retrieval system