KEGG   Pan paniscus (bonobo): 100971466
Entry
100971466         CDS       T02283                                 

Gene name
CDC42SE1
Definition
(RefSeq) CDC42 small effector 1
Organism
pps  Pan paniscus (bonobo)
SSDB
Motif
Pfam: PBD
Other DBs
NCBI-GeneID: 100971466
NCBI-ProteinID: XP_003817332
UniProt: A0A2R9BGD0
Position
1
AA seq 79 aa
MSEFWHKLGCCVVEKPQPKKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQ
EQMRSKGNRDRPWSNSRGL
NT seq 240 nt   +upstreamnt  +downstreamnt
atgagtgaattttggcacaaactgggctgctgtgtggtagagaaaccccagccgaagaag
aagagaagacggattgaccggaccatgattggggaaccaatgaattttgtccacctgact
cacattggctcaggggagatgggggccggagatggacttgccatgacaggtgcagttcag
gagcagatgagatccaagggaaaccgagataggccatggagcaattctaggggcttatag

DBGET integrated database retrieval system