KEGG   Pan paniscus (bonobo): 100971499
Entry
100971499         CDS       T02283                                 

Gene name
IL18
Definition
(RefSeq) interleukin 18
  KO
K05482  interleukin 18
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04061  Viral protein interaction with cytokine and cytokine receptor
pps04621  NOD-like receptor signaling pathway
pps04623  Cytosolic DNA-sensing pathway
pps05132  Salmonella infection
pps05134  Legionellosis
pps05135  Yersinia infection
pps05143  African trypanosomiasis
pps05144  Malaria
pps05152  Tuberculosis
pps05164  Influenza A
pps05321  Inflammatory bowel disease
pps05323  Rheumatoid arthritis
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100971499 (IL18)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100971499 (IL18)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100971499 (IL18)
   04623 Cytosolic DNA-sensing pathway
    100971499 (IL18)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100971499 (IL18)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100971499 (IL18)
   05135 Yersinia infection
    100971499 (IL18)
   05134 Legionellosis
    100971499 (IL18)
   05152 Tuberculosis
    100971499 (IL18)
  09174 Infectious disease: parasitic
   05144 Malaria
    100971499 (IL18)
   05143 African trypanosomiasis
    100971499 (IL18)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100971499 (IL18)
   05321 Inflammatory bowel disease
    100971499 (IL18)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100971499 (IL18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100971499 (IL18)
Cytokines and growth factors [BR:pps04052]
 Cytokines
  Interleukins
   100971499 (IL18)
SSDB
Motif
Pfam: IL1
Other DBs
NCBI-GeneID: 100971499
NCBI-ProteinID: XP_003805502
UniProt: A0A2R9A3C8
Position
11
AA seq 193 aa
MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSVIRNLNDQVLFIDQ
GNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFK
EMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDEL
GDRSIMFTVQNED
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgctgaaccagtagaagacaattgcatcaactttgtggcaatgaaatttattgac
aatacgctttactttatagctgaagatgatgaaaacctggaatcagattactttggcaag
cttgaatctaaattatcagtcataagaaatttgaatgaccaagttctcttcattgaccaa
ggaaatcggcctctatttgaagatatgactgattctgactgtagagataatgcaccccgg
accatatttattataagtatgtataaagatagccagcctagaggtatggctgtaactatc
tctgtgaagtgtgagaaaatttcaactctctcctgtgagaacaaaattatttcctttaag
gaaatgaatcctcctgataacatcaaggatacaaaaagtgacatcatattctttcagaga
agtgtcccaggacatgataataagatgcaatttgaatcttcatcatatgaaggatacttt
ctagcttgtgaaaaagagagagacctttttaaactcattttgaaaaaagaggatgaattg
ggggatagatctataatgttcactgttcaaaacgaagactag

DBGET integrated database retrieval system