KEGG   Pan paniscus (bonobo): 100971583
Entry
100971583         CDS       T02283                                 

Gene name
ZMYND10
Definition
(RefSeq) zinc finger MYND-type containing 10
  KO
K24030  zinc finger MYND domain-containing protein 10
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pps04812]
    100971583 (ZMYND10)
Cytoskeleton proteins [BR:pps04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     Dynein-related proteins
      100971583 (ZMYND10)
SSDB
Motif
Pfam: zf-MYND
Other DBs
NCBI-GeneID: 100971583
NCBI-ProteinID: XP_003818856
UniProt: A0A2R9AMK6
Position
3
AA seq 440 aa
MGDLELLLPGEAEVLVRGLRSFPLREMGSEGWNQQHENLEKLNMQAILDATVSQGEPIQE
LLVTHGKVPTLVEELIAVEMWKQKVFPVLCRVEDFKPQNTFPIYMVVHHEASIINLLETV
FFHKEVCESAEDTVLDLVDYCHRKLTLLVAQSGCGGPPEGEGSQDSNPMQELQKQAELME
FEIALKALSVLRYITDCVDSLSLSTLSRMLSTHNLPCLLVELLEHSPWSRREGGKLQQFE
GSRWHTVAPSEQQKLSKLDGQVWIALYNLLLSPEAQARYCLTSFAKGRLLKLRAFLTDTL
LDQLPNLAHLQSFLAHLTLTETQPPKKDLVLEQIPEIWERLERENRGKWQAIAKHQLQHV
FSPSEQDLRLQARRWAETYRLDVLEAVAPEWPRCAYCSAEASKRCSRCQNEWYCCRECQV
KHWEKHGKTCVLAAQGDRAK
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgggagacctggaactgctgctgcccggggaagctgaagtgctggtgcggggtctgcgc
agcttcccgctacgcgagatgggctccgaagggtggaaccagcagcatgagaacctggag
aagctgaacatgcaagccatcctcgatgccacagtcagccagggcgagcccattcaggag
ctgctggtcacccatgggaaggtcccaacactggtggaggagcttatcgcagtggagatg
tggaagcagaaggtgttccctgtgctctgcagggtggaggacttcaagccccagaacacc
ttccccatctacatggtggtgcaccacgaggcctccatcatcaacctcttggagacagtg
ttcttccacaaggaggtgtgtgagtcagcagaagacactgtcttggacttggtagactat
tgccaccgcaaactgaccctgctggtggcccagagtggctgtggtggcccccctgagggg
gagggatcccaggacagcaaccccatgcaggagctgcagaagcaggcagagctgatggaa
tttgagattgcactgaaggccctctcagtactacgctacatcacagactgtgtggacagc
ctctctctcagcaccttgagccgtatgcttagcacacacaacctgccctgcctcctggtg
gaactgctggagcatagtccctggagccggcgggaaggaggcaagctgcagcagttcgag
ggcagccgttggcatactgtggccccctcagagcagcaaaagctgagcaagttggacggg
caagtgtggatcgccctgtacaacctgctgctaagccctgaggctcaggcgcgctactgc
ctcacaagttttgccaagggacggctactcaagcttcgggccttcctcacagacacacta
ctggaccagctgcccaacctggcccacttgcagagtttcctggcccatctgaccctaact
gaaacccagcctcctaagaaggacctggtgttggaacagatcccagaaatctgggagcgg
ctggagcgagaaaacagaggcaagtggcaggcaattgccaagcaccagctccagcatgtg
ttcagcccctcagagcaggacctgcgcctgcaggcgcgaaggtgggctgagacctacagg
ctggatgtgctagaggcagtggctccagagtggccccgctgtgcttactgcagtgcagag
gcttctaagcgctgctcacgatgccagaatgagtggtattgctgcagggagtgccaagtc
aagcactgggaaaagcatggaaagacttgtgtcctggcagcccagggtgacagagccaaa
tga

DBGET integrated database retrieval system