KEGG   Pan paniscus (bonobo): 100971620
Entry
100971620         CDS       T02283                                 

Gene name
STAT1
Definition
(RefSeq) signal transducer and activator of transcription 1
  KO
K11220  signal transducer and activator of transcription 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04062  Chemokine signaling pathway
pps04217  Necroptosis
pps04380  Osteoclast differentiation
pps04620  Toll-like receptor signaling pathway
pps04621  NOD-like receptor signaling pathway
pps04625  C-type lectin receptor signaling pathway
pps04630  JAK-STAT signaling pathway
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04917  Prolactin signaling pathway
pps04919  Thyroid hormone signaling pathway
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps04935  Growth hormone synthesis, secretion and action
pps05140  Leishmaniasis
pps05145  Toxoplasmosis
pps05152  Tuberculosis
pps05160  Hepatitis C
pps05161  Hepatitis B
pps05162  Measles
pps05164  Influenza A
pps05165  Human papillomavirus infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05171  Coronavirus disease - COVID-19
pps05200  Pathways in cancer
pps05212  Pancreatic cancer
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pps05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100971620 (STAT1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100971620 (STAT1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100971620 (STAT1)
   04621 NOD-like receptor signaling pathway
    100971620 (STAT1)
   04625 C-type lectin receptor signaling pathway
    100971620 (STAT1)
   04658 Th1 and Th2 cell differentiation
    100971620 (STAT1)
   04659 Th17 cell differentiation
    100971620 (STAT1)
   04062 Chemokine signaling pathway
    100971620 (STAT1)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100971620 (STAT1)
   04935 Growth hormone synthesis, secretion and action
    100971620 (STAT1)
   04919 Thyroid hormone signaling pathway
    100971620 (STAT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100971620 (STAT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100971620 (STAT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100971620 (STAT1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100971620 (STAT1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100971620 (STAT1)
   05160 Hepatitis C
    100971620 (STAT1)
   05171 Coronavirus disease - COVID-19
    100971620 (STAT1)
   05164 Influenza A
    100971620 (STAT1)
   05162 Measles
    100971620 (STAT1)
   05168 Herpes simplex virus 1 infection
    100971620 (STAT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100971620 (STAT1)
   05169 Epstein-Barr virus infection
    100971620 (STAT1)
   05165 Human papillomavirus infection
    100971620 (STAT1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100971620 (STAT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100971620 (STAT1)
   05140 Leishmaniasis
    100971620 (STAT1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100971620 (STAT1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100971620 (STAT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pps03000]
    100971620 (STAT1)
Transcription factors [BR:pps03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100971620 (STAT1)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind STAT1_TAZ2bind SH2 TRPM_tetra BLI1
Other DBs
NCBI-GeneID: 100971620
NCBI-ProteinID: XP_003825332
Position
2B
AA seq 750 aa
MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQ
RFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNR
EHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNALINDELVEWK
RRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQV
LWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTN
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAE
PRNLSFFLTPPCARWAQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNASPDGLIPWT
RFCKENINDKNFPFWLWIESILELIKKHLLPLWNDGCIMGFISKERERALLKDQQPGTFL
LRFSESSREGAITFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTT
DNLLPMSPEEFDEVSRIVGSVEFDSMMNTV
NT seq 2253 nt   +upstreamnt  +downstreamnt
atgtctcagtggtacgaacttcagcagcttgactcaaaattcctggagcaggttcaccag
ctttatgatgacagttttcccatggaaatcagacagtacctagcacagtggttagaaaag
caagactgggagcacgctgccaatgatgtttcatttgccaccatccgttttcatgacctc
ctgtcacagctggatgatcaatatagtcgcttttctttggagaataacttcttgctacag
cataacataaggaaaagcaagcgtaatcttcaggataattttcaggaagacccaatccag
atgtctatgatcatttacagctgtctgaaggaagaaaggaaaattctggaaaacgcccag
agatttaatcaggctcagtcggggaatattcagagcacagtgatgttagacaaacagaaa
gagcttgacagtaaagtcagaaatgtgaaggacaaggttatgtgtatagagcatgaaatc
aagagcctggaagatttacaagatgaatatgacttcaaatgcaaaaccttgcagaacaga
gaacacgagaccaatggtgtggcaaagagtgatcagaaacaagaacagctgttactcaag
aagatgtatttaatgcttgacaataagagaaaggaagtagttcacaaaataatagagttg
ctgaatgtcactgaacttacccagaatgccctgattaatgatgaactagtagagtggaag
cggagacagcagagcgcatgtattggggggccgcccaatgcttgcttggatcagctgcag
aactggttcactatagttgcggagagtctgcagcaagttcggcagcagcttaaaaagttg
gaggaattggaacagaaatacacctatgaacatgaccctatcacaaaaaacaaacaagtg
ttatgggaccgcaccttcagtcttttccagcagctcattcagagctcgtttgtggtggaa
agacagccctgcatgccaacgcaccctcagaggccgctggtcttgaagaccggggtccag
ttcactgtgaagttgagactgttggtgaaattgcaagagctgaattataatttgaaagtc
aaagtcttatttgataaagatgtgaatgagagaaatacagtaaaaggatttaggaagttc
aacattttgggcacgcacacaaaagtgatgaacatggaggagtccaccaatggcagtctg
gcggctgaatttcggcacctgcaattgaaagaacagaaaaatgctggcaccagaacgaat
gagggtcctctcatcgttactgaagagcttcactcccttagttttgaaacccaattgtgc
cagcctggtttggtaattgacctcgagacgacctctctgcccgttgtggtgatctccaac
gtcagccagctcccaagcggttgggcctccatcctttggtacaacatgctggtggcggaa
cccaggaatctgtccttcttcctgactccaccatgtgcacgatgggctcagctttcagaa
gtgctgagttggcagttttcttctgtcaccaaaagaggtctcaatgtggaccagctgaac
atgttgggagagaagcttcttggtcctaacgccagccccgatggtctcattccgtggacg
aggttttgtaaggaaaatataaatgataaaaattttcccttctggctttggattgaaagc
atcctagaactcattaaaaaacacctgctccctctctggaatgatgggtgcatcatgggc
ttcatcagcaaggagcgagagcgtgccctgttgaaggaccagcagccggggaccttcctg
ctgcggttcagtgagagctcccgggaaggggccatcacattcacatgggtggagcggtcc
cagaacggaggcgaacctgacttccatgcggttgaaccctacacgaagaaagaactttct
gctgttactttccctgacatcattcgcaattacaaagtcatggctgctgagaatattcct
gagaatcccctgaagtatctgtatccaaatattgacaaagaccatgcctttggaaagtat
tactccaggccaaaggaagcaccagagccaatggaacttgatggccctaaaggaactgga
tatatcaagactgagttgatttctgtgtctgaagttcacccttctagacttcagaccaca
gacaacctgctccccatgtctcctgaggagtttgacgaggtgtctcggatagtgggctct
gtagaattcgacagtatgatgaacacagtatag

DBGET integrated database retrieval system