KEGG   Pan paniscus (bonobo): 100971622Help
Entry
100971622         CDS       T02283                                 

Gene name
CC2D2B
Definition
(RefSeq) coiled-coil and C2 domain containing 2B
Organism
pps  Pan paniscus (bonobo)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 100971622
NCBI-ProteinID: XP_003825448
UniProt: A0A2R9BXC1
Position
10
AA seq 322 aa AA seqDB search
MMTEKHEDHCLKSCSGHSYIRKSWLGSIVFPFSALLQQSEFLDQTEVLQRAQIFKKNCKA
MFPNRRIVTTVFNDEGIQFLVTRYIKALNPPQQLLDIFLHNSNATFDLIARFVSLIPFVP
NTPDENDGSDIWMTSEHCISLAIGNKEEHAILLCNFFLYFGKKALVLLGTSVLEGHVAYV
VTQETNEYLLWNPSTGQCYKQFDPFCPLKSVDCLFDDRNVWFNIQQNNTPMAVFFDYSKE
SFWKQLLPKNVQGTKIQSIQVTGFPIQMPYIDVQSIIDAVYQTGIHSAEFPQTEFALAVY
IHPYPNNILSVWVYLASLVQHQ
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgatgactgaaaaacatgaggatcactgtctcaagagctgtagtggtcactcatatata
agaaagagttggcttggatccattgtcttccctttttctgctcttctgcaacaatctgag
tttttagatcaaacagaggtcttgcagagagcacagatttttaaaaagaattgtaaggca
atgttccccaaccgaagaatcgtaactactgtttttaatgatgaagggatacagttctta
gtcacaagatatatcaaggcattaaatccacctcagcaacttctggatatatttcttcac
aattctaatgcaacatttgacctcattgctcgatttgtatctttgattccttttgtgcct
aatacaccagatgaaaatgatggctctgatatatggatgacatcagagcactgcatcagt
ttagctatcggaaataaggaggagcatgccatccttctctgtaatttctttctgtatttt
ggaaagaaggcactggtcctcttgggaacgtcagtgttagaagggcatgtggcttatgta
gtaactcaagaaactaatgaatatttgctttggaatccatcaactggccaatgttataag
cagtttgacccgttttgtcccttaaaaagtgtagattgtttgtttgatgatagaaatgtc
tggtttaatattcaacaaaataatacaccaatggctgtattttttgactattcaaaggaa
agtttctggaagcagttgcttccaaaaaacgttcaaggaacaaaaatacaaagcatacag
gtcacgggatttcccatccagatgccatacattgatgtacagtcaattattgatgctgtt
tatcaaactggaattcactctgctgaatttccccagacagaatttgctttagctgtatac
attcacccatacccaaacaacatattatctgtgtgggtctatttggcttccttagttcaa
catcaatga

DBGET integrated database retrieval system