KEGG   Pan paniscus (bonobo): 100971645Help
Entry
100971645         CDS       T02283                                 

Gene name
FBXL22
Definition
(RefSeq) F-box and leucine rich repeat protein 22
  KO
K10288  F-box and leucine-rich repeat protein 22
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pps04121]
    100971645 (FBXL22)
Ubiquitin system [BR:pps04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     100971645 (FBXL22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: F-box-like F-box F-box_4
Motif
Other DBs
NCBI-GeneID: 100971645
NCBI-ProteinID: XP_003827992
UniProt: A0A2R9CGD1
Position
15
AA seq 247 aa AA seqDB search
MWPLLTMHITQLNRECLLHLFSFLDKDSRKSLARTCSQLHDVFEDPALWSLLHFRSLTEL
QKDNFLLGPALRSLSICWHSSRVQVCSIEDWLKSAFQRSICSRHESLVNDFLLRVCDRLS
AVRSPRRREAPAPSSGTPIAVGPKSPRWGGPDHSEFADLRAGVTGARAAARRGLGSLRAE
RPSETPPAPGVSWGPPPPGAPVVISVKQEEGKQGRTGRRSHRAAPPCGFARTRVCPPTFP
GADAFPE
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgtggccactgctcaccatgcacataacccagctcaaccgggagtgcctgctgcacctc
ttctccttcctagacaaggacagcaggaagagccttgccaggacctgctcccagctccac
gacgtgtttgaggaccccgcactctggtccctgctgcacttccgttccctcactgaactc
cagaaggacaacttcctcctgggcccggcactccgcagcctctccatctgctggcactcc
agccgcgtgcaggtgtgcagcattgaggactggctcaagagtgccttccagagaagcatc
tgcagccggcacgagagcctggtcaatgatttcctcctccgggtgtgcgacaggctttct
gctgtgcgctccccacggaggcgggaggcgcctgcaccgtcctcggggactccgatcgcc
gttggaccgaaatcacctcggtggggaggacctgaccactcggagttcgccgacttgcgc
gcgggggtgacgggggccagggctgccgcgcgcaggggtctggggagcctccgggcggag
cgacccagcgagaccccgccggctcccggagtgtcctggggaccgccgcctccaggggcc
ccggtagtgatctcggtgaagcaggaggaggggaagcaggggcgcacgggcagaaggagc
caccgagccgctcctccttgcggttttgcccgcacgcgcgtctgcccgcccacctttcct
ggggcggatgcgttcccggagtga

DBGET integrated database retrieval system