KEGG   Pan paniscus (bonobo): 100971982
Entry
100971982         CDS       T02283                                 

Gene name
IWS1
Definition
(RefSeq) IWS1, SUPT6H interacting protein
  KO
K17498  transcription factor SPN1
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pps03021]
    100971982 (IWS1)
Transcription machinery [BR:pps03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     100971982 (IWS1)
SSDB
Motif
Pfam: Med26
Other DBs
NCBI-GeneID: 100971982
NCBI-ProteinID: XP_003828308
UniProt: A0A2R9C5I5
Position
2B
AA seq 819 aa
MDSEYYSGDQSDDGGATPVQDERDSGSDGEDDVNEQHSGSDTGSVERHSENETSDREDGL
PKGHHVTDSENDEPLNLNASDSESEELHRQKDSDSESEERAEPPASDSENEDVNQHGSDS
ESEETRKLPGSDSENEELLNGHASDSENEDVEKHPASDSEIEELQKSPASDSETEDALKP
QISDSESEEPPRHQASDSENEEPPKPRMSDSESEELPKPQVSDSESEEPQRHQASDSENE
ELPKPRISDSESEDPPRHQASDSENEELPKPRISDSESEDPPRNQASDSENEELPKPRVS
DSESEGPLKGPASDSETEDASRHKQKPESDDDSDRENKREDTEMQNDSFHSDSHMDRKKF
HSSDSEEEEHKKQKMDSDEDEKEGEEEKVAKRKAAVLSDSEDEEKASAKKSRVVSDADDS
DSDAVSDKSGKREKTIASDSEEEAGKELSDKKNEEKDLFGSDSESGNEEENLIADIFGES
GDEEEEEFTGFNQEDLEEEKGETQVKEAEDSDSDDNIKRGKHMDFLSDFEMMLQRKKSMS
GKRRRNRDGGTFISDADDVVSAMIVKMNEAAEEDRQLNNQKKPALKKLTLLPTVVMHLKK
QDLKETFIDSGVMSAIKEWLSPLPDRSLPALKIREELLKILQELPSVSQETLKHSGIGRA
VMYLYKHPKESRSNKDMAGKLINEWSRPIFGLTSNYKGMTREEREQRDLEQMPQRRRMNS
TGGQTPRRDLEKVLTGEEKALRPGDPGFCARARVPMPSNKDYVVRPKWNVEMESSRFQAT
SKKGISRLDKQMRKFTDIRKKSRSAHAVKISIEGNKMPL
NT seq 2460 nt   +upstreamnt  +downstreamnt
atggactcggaatattacagcggcgaccagtcagatgatggtggtgctaccccagtacag
gatgaacgggattcagggtcagacggtgaggatgatgtaaatgagcaacactccggatca
gacactggaagtgtagaacgtcattcagagaatgaaactagtgatcgagaagatggcctc
cccaaaggacatcatgtgacagactctgagaacgatgagcccttaaatcttaatgctagt
gactctgaaagtgaggagcttcacaggcaaaaggacagcgactctgaatctgaggaacgt
gcagagcctcctgcaagcgattctgaaaatgaggatgtcaatcagcatgggagcgactct
gagagtgaagagaccaggaaattacctggtagtgactctgaaaatgaggaacttcttaat
gggcatgcaagtgactcagaaaacgaagatgttgagaagcatcccgccagtgattctgag
attgaggagctccagaagagtcctgctagtgactctgaaacagaagatgctctaaaacct
caaatcagtgactctgagagtgaggaacccccaaggcaccaagccagtgactccgaaaat
gaggagcctcccaaacctcgaatgagtgattctgaaagtgaggagcttcctaaacctcag
gtcagtgattcagaaagtgaggaaccccaacggcaccaggccagtgactctgaaaatgag
gagcttcccaaacctcgtatcagtgactcagaaagtgaggaccctccgaggcaccaggcc
agtgactcagaaaatgaagagcttcccaaaccccgaatcagtgattcggaaagtgaggat
cccccaaggaaccaggccagtgattctgaaaatgaggagctacccaaaccccgagtcagt
gactctgagagtgaggggcctctgaaggggcctgccagtgactcagaaactgaggatgcg
tccagacacaaacagaagccagagtcagatgatgacagcgacagggagaataagagagag
gatacagaaatgcagaatgactccttccattcagacagccatatggacagaaaaaagttt
cacagttctgatagtgaggaggaagaacacaaaaagcaaaaaatggacagtgatgaagat
gaaaaagagggtgaggaggagaaagtagcgaagagaaaagctgctgtgctttctgatagt
gaagatgaagagaaagcatcagcaaagaagagtcgtgttgtctctgatgcagatgactct
gacagtgatgctgtatcagacaagtcaggcaaaagagagaagaccatagcatctgacagt
gaggaagaagctgggaaagaattgtctgataagaaaaatgaagagaaggatctgtttggg
agtgacagtgagtcaggcaatgaagaagaaaatcttattgcagacatatttggagaatct
ggtgatgaagaggaagaagaatttacaggttttaaccaagaagatctggaagaagaaaaa
ggtgaaacacaggtaaaagaagcggaagattcagattctgatgataacataaagagagga
aaacatatggactttctgtcagattttgagatgatgttgcagcgaaaaaagagcatgagt
ggcaagcgcagacggaaccgcgatggtggcacctttattagtgatgcagacgacgtcgtg
agtgccatgatcgtcaagatgaatgaagctgctgaggaagacagacagttgaacaatcaa
aaaaagccagcactgaaaaaattaactttactgcctactgtagttatgcaccttaagaag
caggaccttaaagaaacattcattgacagtggtgtgatgtctgccatcaaagaatggctc
tcacctctaccagataggagtttgcctgcactcaagatccgggaggagctgctgaagatc
ctgcaagagctgcctagtgtgagccaggagaccctgaagcatagtgggattggacgagca
gtgatgtatctctataaacaccccaaggaatcaaggtccaacaaggacatggcagggaaa
ttaatcaatgagtggtctaggcctatatttggtcttacctcaaactacaaaggaatgaca
agagaagaaagggagcagagagatctagaacagatgcctcaacgacgaagaatgaacagc
actggtggtcagacacccagaagagacctggaaaaggtgctgacaggagaggagaaggct
cttagacctggagatcctggattctgtgcccgtgcaagggtcccaatgccttcaaacaag
gactatgttgtcaggcccaaatggaatgtggaaatggagtcatccaggtttcaggcgacc
tccaagaagggtatcagtcgactggataaacagatgagaaagttcacagatataaggaaa
aaaagcagatctgcacacgcagtgaaaatcagcattgagggcaacaaaatgccattgtga

DBGET integrated database retrieval system