KEGG   Pan paniscus (bonobo): 100972035
Entry
100972035         CDS       T02283                                 

Gene name
JAK3
Definition
(RefSeq) Janus kinase 3
  KO
K11218  Janus kinase 3 [EC:2.7.10.2]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04062  Chemokine signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04217  Necroptosis
pps04550  Signaling pathways regulating pluripotency of stem cells
pps04630  JAK-STAT signaling pathway
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps05161  Hepatitis B
pps05162  Measles
pps05166  Human T-cell leukemia virus 1 infection
pps05169  Epstein-Barr virus infection
pps05200  Pathways in cancer
pps05203  Viral carcinogenesis
pps05223  Non-small cell lung cancer
pps05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100972035 (JAK3)
   04151 PI3K-Akt signaling pathway
    100972035 (JAK3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100972035 (JAK3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100972035 (JAK3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100972035 (JAK3)
   04659 Th17 cell differentiation
    100972035 (JAK3)
   04062 Chemokine signaling pathway
    100972035 (JAK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100972035 (JAK3)
   05203 Viral carcinogenesis
    100972035 (JAK3)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    100972035 (JAK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100972035 (JAK3)
   05161 Hepatitis B
    100972035 (JAK3)
   05162 Measles
    100972035 (JAK3)
   05169 Epstein-Barr virus infection
    100972035 (JAK3)
  09163 Immune disease
   05340 Primary immunodeficiency
    100972035 (JAK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100972035 (JAK3)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100972035 (JAK3)
Protein kinases [BR:pps01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   100972035 (JAK3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl Kdo ABC1 Kinase-like APH LRR_RI_capping Haspin_kinase
Other DBs
NCBI-GeneID: 100972035
NCBI-ProteinID: XP_014198041
Position
19
AA seq 1172 aa
MTVAQETKGPTQEGAEWDFPLAASWLCPPFEGPGSLPARQVALMAPPSEETPLIPQRSCS
LLSTEAGALHVLLPARGPGPPQRLSFSFGDHLAEDLCVQAAKASGILPVYHSLFALATED
LSCWFPPSHIFSVEDASTQVLLYRIRFYFPNWFGLEKCHRFGLRKDLASAILDLPVLEHL
FAQHRSDLVSGRLPMGLSLKEQGECLSLAVLDLARMAREQAQRPGELLKTVSYKACLPPS
LRDLIQGLSFVTRRRIRRTVRRALRRVAACQADRHSLMAKYIMDLERLDPAGAAETFHVG
LPGALGGHDGLGLLRVAGDGGIAWTQGEQEVLQPFCDFPEIVDISIKQAPRVGPAGEHRL
VTVTRTDNQILEAEFPGLPEALSFVALVDGYFRLTTDSQHFFCKEVAPPRLLEEVAEQCH
GPITLDFAINKLKTGGSHPGSYVLRRSPQDFDSFLLTVCVQVGLLLGWVVEGCLEEVTFE
LRFKRSPSGVFISGSASRGYLKLRHELANSWGLFTSDXLVFLPHPLPIEKSNLIVVQRGH
SPPTSSLVQPQSQYQLSQMTFHKIPADSLEWHENLGHGSFTKIYRGCRHEVVDGEARKTE
VLLKVMDAKHKNCMESFLEAASLMSQVSYRHLVLLHGVCMAGDSTMVQEFVHLGAIDMYL
RKRGHLVPASWKLQVVKQLAYALNYLEDKGLPHGNVSARKVLLAREGADGSPPFIKLSDP
GVSPAVLSLEMLTDRIPWVAPECLREAQTLSLEADKWGFGATVWEVFSGVTMPISALDPA
KKLQFYEDRQQLPAPKWTELALLIQQCMAYEPVQRPSFRAVIRDLNSLISSDYELLSDPT
PGALAPRDGLWNGAQLYACQDPTIFEERHLKYISQLGKGNFGSVELCRYDPLGDNTGALV
AVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRLVMEYLPSGCLRD
FLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVHRDLAARNILVESEAHVKIADFGLAK
LLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPSA
EFLRMMGCERDVPALCRLLELLEEGQRLPAPPACPAEVHELMKLCWAPSPQDRPSFSALG
PQLDMLWSGSRGCETHAFTAHPEGKHHSLSFS
NT seq 3519 nt   +upstreamnt  +downstreamnt
atgacagtggctcaggaaaccaaggggcccacacaggaaggagccgagtgggactttcct
ctcgctgcctcctggctctgccctcccttcgaaggtccagggtccctgcccgctaggcaa
gttgcactcatggcacctccaagtgaagagacgcccctgatccctcagcgttcatgcagc
ctcttgtccacggaggctggtgccctgcatgtgctgctgcccgctcggggccccgggccc
ccccagcgcctatctttctcctttggggaccacttggctgaggacctgtgcgtgcaggct
gccaaggccagcggcatcctgcctgtgtaccactccctctttgctctggccacggaggac
ctgtcctgctggttccccccgagccacatcttctccgtggaggatgccagcacccaagtc
ctgctctacaggattcgcttttacttccccaattggtttgggctggagaagtgccaccgc
ttcgggctacgcaaggatttggccagtgctatccttgacctgccagtcctggagcacctc
tttgcccagcaccgcagtgacctggtgagtgggcgcctccccatgggcctcagtctcaag
gagcagggtgagtgtctcagcctggccgtgttggacctggcccggatggcgcgagagcag
gcccagcggccgggagagctgctgaagactgtcagctacaaggcctgcctacccccaagc
ctgcgcgacctgatccagggcctgagcttcgtgacgcggaggcgtattcggaggacggtg
cgcagagccctgcgccgcgtggccgcctgccaggcagaccggcactcgctcatggccaag
tacatcatggacctggagcggctggatccagccggggccgccgagaccttccacgtgggc
ctccctggggcccttggtggccacgacgggctggggctgctccgcgtggctggtgacggc
ggcatcgcctggacccagggagaacaggaggtcctccagcccttctgcgactttccagaa
atcgtagacattagcatcaagcaggccccgcgcgttggcccggccggagagcaccgcctg
gtcactgttaccaggacagacaaccagattttagaggccgagttcccagggctgcccgag
gctctgtcgttcgtggcgctcgtggacggctacttccggctgaccacggactcccagcac
ttcttctgcaaggaggtggcaccgccgaggctgctggaggaagtggccgagcagtgccac
ggccccatcactctggactttgccatcaacaagctcaagactgggggctcacatcctggc
tcctatgttctccgccgcagcccccaggactttgacagcttcctcctcactgtctgtgtc
caggtcggtctactgctagggtgggtagtggagggctgcctggaggaggtgacgtttgag
ttgagatttaaaagatcaccttcgggagtcttcatctcagggtcggcttctagagggtac
ctcaaactaaggcatgagttagctaactcttggggacttttcacctctgatnttctggtt
tttctccctcatcctctccccatagaaaagtccaacctgatcgtggtccagagaggtcac
agcccacccacatcatccttggttcagccccaatcccaataccagctgagtcagatgaca
tttcacaagatccctgctgacagcctggagtggcatgagaacctgggccatgggtccttc
accaagatttaccggggctgtcgccatgaggtggtggatggggaggcccgaaagacagag
gtgctgctgaaggtgatggatgccaagcacaagaactgcatggagtcattcctggaagca
gcgagcttgatgagccaagtgtcgtaccggcatctcgtgctgctccacggcgtgtgcatg
gctggagacagcaccatggtgcaggaatttgtacacctgggggccatagacatgtatctg
cgaaaacgtggccacctggtgccagccagctggaagctgcaggtggtcaaacagctggcc
tacgccctcaactatctggaggacaaaggcctcccccatggcaatgtctctgcccggaag
gtgctcctggctcgggagggggctgatgggagcccgcccttcatcaagctgagtgaccct
ggggtcagccctgctgtgttaagcctggagatgctcaccgacaggatcccctgggtggcc
cccgagtgtctccgggaggcccagacacttagcttggaagctgacaagtggggcttcggc
gccacggtctgggaagtgtttagtggcgtcaccatgcccatcagcgccctggatcctgct
aagaaactccaattttatgaggaccggcagcagctgccggcccccaagtggacagagctg
gccctgctgattcaacagtgcatggcctatgagccggtccagaggccctccttccgagcc
gtcattcgtgacctcaatagcctcatctcttcagactatgagctcctctcagaccccaca
cctggtgccctggcacctcgtgatgggctgtggaatggtgcccagctctatgcctgccaa
gaccccacgatcttcgaggagagacacctcaagtacatctcacagctgggcaagggcaac
tttggcagtgtggagctgtgccgctatgacccgctaggcgacaatacaggtgccctggtg
gccgtgaaacagctgcagcacagcgggccagaccagcagagggactttcagcgggagatt
cagatcctcaaagcactgcacagtgatttcattgtcaagtatcgtggtgtcagctatggc
ccgggccgccagagcctgcggctggtcatggagtacctgcccagcggctgcttgcgcgac
ttcctgcagcggcaccgcgcgcgcctcgatgccagccgcctccttctctattcctcgcag
atctgcaagggcatggagtacctgggctcccgccgctgcgtgcaccgcgacctggccgcc
cgaaacatcctcgtggagagcgaggcacacgtcaagatcgctgacttcggcctagctaag
ctgctgccgcttgacaaagactactacgtggtccgcgagccgggccagagccccattttc
tggtatgcccccgaatccctctcggacaacatcttctctcgccagtcagacgtctggagc
ttcggggtcgtcctgtacgagctcttcacctactgcgacaaaagctgcagcccctcggcc
gagttcctgcggatgatgggatgtgagcgggatgtccccgccctctgccgcctcttggaa
ctgctggaggagggccagaggctgccggcgcctcctgcctgccctgctgaggttcacgag
ctcatgaagctgtgctgggcccctagcccacaggaccggccatcattcagcgccctgggc
ccccagctggacatgctgtggagcggaagccgggggtgtgagactcatgccttcactgct
cacccagagggcaaacaccactccctgtccttttcatag

KEGG   Pan paniscus (bonobo): 100972202
Entry
100972202         CDS       T02283                                 

Gene name
JAK1
Definition
(RefSeq) Janus kinase 1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps04151  PI3K-Akt signaling pathway
pps04217  Necroptosis
pps04380  Osteoclast differentiation
pps04550  Signaling pathways regulating pluripotency of stem cells
pps04621  NOD-like receptor signaling pathway
pps04630  JAK-STAT signaling pathway
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps05140  Leishmaniasis
pps05145  Toxoplasmosis
pps05152  Tuberculosis
pps05160  Hepatitis C
pps05161  Hepatitis B
pps05162  Measles
pps05163  Human cytomegalovirus infection
pps05164  Influenza A
pps05165  Human papillomavirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05171  Coronavirus disease - COVID-19
pps05200  Pathways in cancer
pps05203  Viral carcinogenesis
pps05212  Pancreatic cancer
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100972202 (JAK1)
   04151 PI3K-Akt signaling pathway
    100972202 (JAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100972202 (JAK1)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100972202 (JAK1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100972202 (JAK1)
   04658 Th1 and Th2 cell differentiation
    100972202 (JAK1)
   04659 Th17 cell differentiation
    100972202 (JAK1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100972202 (JAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100972202 (JAK1)
   05203 Viral carcinogenesis
    100972202 (JAK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100972202 (JAK1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100972202 (JAK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100972202 (JAK1)
   05161 Hepatitis B
    100972202 (JAK1)
   05160 Hepatitis C
    100972202 (JAK1)
   05171 Coronavirus disease - COVID-19
    100972202 (JAK1)
   05164 Influenza A
    100972202 (JAK1)
   05162 Measles
    100972202 (JAK1)
   05168 Herpes simplex virus 1 infection
    100972202 (JAK1)
   05163 Human cytomegalovirus infection
    100972202 (JAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100972202 (JAK1)
   05169 Epstein-Barr virus infection
    100972202 (JAK1)
   05165 Human papillomavirus infection
    100972202 (JAK1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100972202 (JAK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100972202 (JAK1)
   05140 Leishmaniasis
    100972202 (JAK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100972202 (JAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100972202 (JAK1)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100972202 (JAK1)
Protein kinases [BR:pps01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   100972202 (JAK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 Jak1_Phl FERM_F1 ABC1 SH2 TCAD9
Other DBs
NCBI-GeneID: 100972202
NCBI-ProteinID: XP_008957192
Position
1
AA seq 1154 aa
MQYLNIKEDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVIFYLSDREPLRLGSGEYTAEEL
CIRAAQACRISPLCHNLFALYDENTKLWYAPNRTITVGDKMSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKKIPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMN
WFHSNDSGNVLYYEVMVTGNLGIQWRHKPNVVSVEKEKNKLKRKKLENKHKKDEEKNKIR
EEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT
CFEKSEQVQGAQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFML
KRCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDLVQGEHLGRGTRTHIYSG
TLMDYKDDEGTSEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRD
VENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNL
LLAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFG
TTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRA
IMRDINKLEEQNPDIVSXKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDN
TGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLP
SGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIG
DFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDS
DSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRT
SFQNLIEGFEALLK
NT seq 3465 nt   +upstreamnt  +downstreamnt
atgcagtatctaaatataaaagaggactgcaatgccatggctttctgtgctaaaatgagg
agctccaagaagactgaggtgaacctggaggcccctgagccaggggtggaagtgatcttc
tatctgtcggacagggagcccctccggctgggcagtggagagtacacagcagaggaactg
tgcatcagggctgcacaggcatgccgtatctctcctctttgtcacaacctctttgccctg
tatgacgagaacaccaagctctggtatgctccaaatcgcaccatcaccgttggtgacaag
atgtccctccggctccactaccggatgaggttctatttcaccaattggcatggaaccaac
gacaatgagcagtcagtgtggcgtcattctccaaagaagcagaaaaatggctacgagaaa
aaaaagattccagatgcaacccctctccttgatgccagctcactggagtatctgtttgct
cagggacagtatgatttggtgaaatgcctggctcctattcgagaccccaagaccgagcag
gatggacatgatattgagaacgagtgtctagggatggctgtcctggccatctcacactat
gccatgatgaagaagatgcagttgccagaactgcccaaggacatcagctacaagcgatat
attccagaaacattgaataagtccatcagacagaggaaccttctcaccaggatgcggata
aataatgttttcaaggatttcctaaaggaatttaacaacaagaccatttgtgacagcagt
gtgtccacgcatgacctgaaggtgaaatacttggctaccttggaaactttgacaaaacat
tacggtgctgaaatatttgagacttccatgttactgatttcatcagaaaatgagatgaat
tggtttcattcgaatgacagtggaaatgttctctactacgaagtgatggtgactgggaat
cttggaatccagtggaggcataaaccaaatgttgtttctgttgaaaaggaaaaaaataaa
ctgaagcggaaaaaactggaaaataaacacaagaaggatgaggagaaaaacaagatccgg
gaagagtggaacaatttttcttacttccctgaaatcactcacattgtaataaaggagtct
gtggtcagcattaacaagcaggacaacaagaaaatggaactgaagctctcgtcccacgag
gaggccttgtcctttgtgtccctggtagatggctacttccggctcacagcagacgcccat
cattacctctgcaccgacgtggcccccccgttgatcgtccacaacatacagaatggctgt
catggtccaatctgtacagaatacgccatcaataaattgcggcaagaaggaagcgaggag
gggatgtacgtgctgaggtggagctgcaccgactttgacaacatcctcatgaccgtcacc
tgctttgagaagtctgagcaggtgcagggtgcccagaagcagttcaagaactttcagatc
gaggtgcagaagggccgctacagtctgcacggttcggaccgcagcttccccagcttggga
gacctcatgagccacctcaagaagcagatcctgcgcacggataacatcagcttcatgcta
aaacgctgctgccagcccaagccccgagaaatctccaacctgctggtggctactaagaaa
gcccaggagtggcagcccgtctaccccatgagccagctgagtttcgatcggatcctcaag
aaggatctggtgcagggcgagcaccttgggagaggcacgagaacacacatctattctggg
accctaatggattacaaggatgacgaaggaacttctgaagagaagaagataaaagtgatc
ctcaaagtcttagaccccagccacagggatatttccctggccttcttcgaggcagccagc
atgatgagacaggtctcccacaaacacatcgtgtacctctatggcgtctgtgtccgtgac
gtggagaatatcatggtggaagagtttgtggaagggggtcctctggatctcttcatgcac
cggaaaagcgatgtccttaccacaccatggaaattcaaagttgccaaacagctggccagt
gccctgagctacttggaggataaagacctggtccatggaaatgtgtgtactaaaaacctc
ctcctggcccgtgagggcatcgacagtgagtgtggcccattcatcaagctcagtgacccc
ggcatccccattacggtgctgtctaggcaagaatgcattgaacgaatcccatggattgct
cccgagtgtgttgaggactccaagaacctgagtgtggctgctgacaagtggagctttgga
accacgctctgggaaatctgctacaatggcgagatccccttgaaagacaagacgctgatt
gagaaagagagattctatgaaagccggtgcaggccagtgacaccatcatgtaaggagctg
gctgacctcatgacccgctgcatgaactatgaccccaatcagaggcctttcttccgagcc
atcatgagagacattaataagcttgaagagcagaatccagatattgtttcangaaaaaaa
ccagcaactgaagtggaccccacacattttgaaaagcgcttcctaaagaggatccgtgac
ttgggagagggccactttgggaaggttgagctctgcaggtatgaccccgaaggggacaat
acaggggagcaggtggctgttaaatctctgaagcctgagagtggaggtaaccacattgct
gatctgaaaaaggaaatcgagatcttaaggaacctctatcatgagaacattgtgaagtac
aaaggaatctgcacagaagacggaggaaatggtattaagctcatcatggaatttctgcct
tcgggaagccttaaggaatatcttccaaagaataagaacaaaattaacctcaaacagcag
ctaaaatatgccgttcagatttgtaaggggatggactatttgggttctcggcaatacgtt
caccgggacttggcagcaagaaatgtccttgttgagagtgaacaccaagtgaaaattgga
gacttcggtttaaccaaagcaattgaaaccgataaggagtattacaccgtcaaggatgac
cgggacagccctgtgttttggtatgctccagaatgtttaatgcaatcgaaattttatatt
gcctctgacgtctggtcttttggagtcactctgcatgagctgctgacttactgtgattca
gattctagtcccatggctttgttcctgaaaatgataggcccaacccatggccagatgaca
gtcacaagacttgtgaatacattaaaagaaggaaaacgcctgccgtgcccacctaactgt
ccagatgaggtttatcaacttatgaggaaatgctgggaattccaaccatccaatcggaca
agctttcagaaccttattgaaggatttgaagcacttttaaaataa

KEGG   Pan paniscus (bonobo): 100979090
Entry
100979090         CDS       T02283                                 

Gene name
TYK2
Definition
(RefSeq) tyrosine kinase 2
  KO
K11219  non-receptor tyrosine-protein kinase TYK2 [EC:2.7.10.2]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04217  Necroptosis
pps04380  Osteoclast differentiation
pps04621  NOD-like receptor signaling pathway
pps04630  JAK-STAT signaling pathway
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps05145  Toxoplasmosis
pps05160  Hepatitis C
pps05161  Hepatitis B
pps05162  Measles
pps05164  Influenza A
pps05165  Human papillomavirus infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100979090 (TYK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100979090 (TYK2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100979090 (TYK2)
   04658 Th1 and Th2 cell differentiation
    100979090 (TYK2)
   04659 Th17 cell differentiation
    100979090 (TYK2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100979090 (TYK2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    100979090 (TYK2)
   05160 Hepatitis C
    100979090 (TYK2)
   05171 Coronavirus disease - COVID-19
    100979090 (TYK2)
   05164 Influenza A
    100979090 (TYK2)
   05162 Measles
    100979090 (TYK2)
   05168 Herpes simplex virus 1 infection
    100979090 (TYK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100979090 (TYK2)
   05169 Epstein-Barr virus infection
    100979090 (TYK2)
   05165 Human papillomavirus infection
    100979090 (TYK2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100979090 (TYK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100979090 (TYK2)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100979090 (TYK2)
Protein kinases [BR:pps01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   100979090 (TYK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Jak1_Phl FERM_F2 FERM_F1 Kinase-like Kdo APH ABC1
Other DBs
NCBI-GeneID: 100979090
NCBI-ProteinID: XP_008960099
UniProt: A0A2R9C1D6
Position
19
AA seq 1190 aa
MPLRHWGMARGSKPVGDGAQPMAAMGGLKVLLHWAGPGGGEPWVTFSESSLTAEEVCIHI
AHKVGITPPCFNLFALFDAQAQVWLPPNHILEIPRDASLMLYFRIRFYFRNWHGMNPREP
AVYRCGPPGTEASSDQTAQGMQLLDPASFEYLFEQGKHEFVNDVASLWELSSEEEIHHFK
NESLGMAFLHLCHLALRHGIPLQEVAKKTSFKDCIPRSFRRHIRQHSALTRLRLRNVFRR
FLRDFQPGRLSQQMVMVKYLATLERLAPRFGTERVPVCHLRLLAQAEGEPCYIRDSGVAP
TDPGPESAAGPPTHEVLVTGTGGIQWWPVEEEVNKEEGSSGSSGRNPQASLFGKKAKAHK
AVGQLADRPREPLWAYFCDFRDITHVVLKEHCVSIHRQDNKCLELSLPSRAAALSFVSLV
DGYFRLTADSSHYLCHEVAPPRLVMSIRDGIHGPLLEPFVQAKLRPEDGLYLIHWSTSHP
YRLILTVAQRSQAPDGMQSLRLRKFPIEQQDGAFVLEGWGRSFPSVRELGAALQGCLLRA
GDDCFSLRRCCLPQPGETSNLIIMRGARASPRTLNLSQLSFHRVDQKEITQLSHLGQGTR
TNVYEGRLRVEGSGDPEEGKMDDEDPLVPGRDRGQELRVVLKVLDPSHHDIALAFYETAS
LMSQVSHMHLAFVHGVCVRGPENIMVTEYVEHGPLDVWLRRERGHVPMAWKMVVAQQLAS
ALSYLENKNLVHGNVCGRNILLARLGLAEGTSPFIKLSDPGVGLGALSREERVERIPWLA
PECLPVGANSLSTAMDKWGFGATLLEICFDGEAPLQSRSPSEKEHFYQRQHRLPEPSCPE
LATLTSQCLTYEPTQRPSFRTILRDLTRLQPHTLPDLADVLTVNPDSPASDPTVFHKRYL
KKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILRTLYHE
HIIKYKGCCEDQGEKSLQLVMEYVPLGSLRDYLPRHSVGLAQLLLFAQQICEGMAYLHAQ
HYIHRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYK
FYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLRLTELLERGERLPRP
DKCPCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYQGQAPSVFSVC
NT seq 3573 nt   +upstreamnt  +downstreamnt
atgcctctgcgccactgggggatggccaggggcagtaagcccgttggggatggagcccag
cccatggctgccatgggaggcctgaaggtgcttctgcactgggctggtccaggcggcggg
gagccctgggtcactttcagtgagtcatcgctgacagctgaggaagtctgcatccacatt
gcacataaagttggtatcactcctccttgcttcaatctctttgccctcttcgatgctcag
gcccaagtctggttgcccccaaaccacatcctagagatccccagagacgcaagcctgatg
ctatatttccgcataaggttttatttccggaactggcatggcatgaatcctcgggaaccg
gctgtgtaccgttgtgggcccccaggaaccgaggcatcctcagatcagacagcacagggg
atgcaactcctggacccagcctcatttgagtacctctttgagcagggcaagcatgagttt
gtgaatgacgtggcatcactgtgggagctgtcgagcgaggaggagatccaccactttaag
aatgagagcctgggcatggcctttctgcacctctgtcacctcgctctccgccatggcatc
cccctgcaggaggtggccaagaagaccagcttcaaggactgcatcccgcgctccttccgt
cggcatatccggcagcacagcgccctgacccggctgcgccttcggaacgtcttccgcagg
ttcctgcgggacttccagccgggccgactctcccagcagatggtcatggtcaaataccta
gccacactcgagcggctggcaccccgcttcggcacagagcgtgtgcccgtgtgccacctg
aggctgctggcccaggccgagggggagccctgctacatccgggacagtggggtggcccct
acagaccctggccctgagtctgctgctgggcccccaacccacgaggtgctggtgacaggc
actggtggcatccagtggtggccagtagaggaggaggtgaacaaggaggagggttctagt
ggcagcagtggcaggaacccccaagccagcctgtttgggaagaaggccaaggctcacaag
gcagtcggccagctggcagacaggccgcgggagccactgtgggcctacttctgcgacttc
cgggacatcacccacgtggtgctgaaagagcactgtgtcagcatccaccggcaggacaac
aagtgcctggagctgagcttgccttcccgggctgcggcgctgtccttcgtgtcgctggtg
gacggctatttccgcctgacggccgactccagccactacctgtgccacgaggtggctccc
ccacggctggtgatgagcatccgggatgggatccacggacccctgctggagccatttgtg
caggccaagctgcggcccgaggacggcctgtacctcattcactggagcaccagccacccc
taccgcctgatcctcacagtggcccagcgtagccaggcaccagacggcatgcagagcttg
cggctccgaaagttccccattgagcagcaggacggggccttcgtgctggagggctggggc
cggtccttccccagcgttcgggaacttggggctgccttgcagggctgcttgctgagggcc
ggggatgactgcttctctctgcgtcgctgttgcctgccccaaccaggagaaacctccaat
ctcatcatcatgcggggggctcgggccagccccaggacactcaacctcagccagctcagc
ttccaccgggttgaccagaaggagatcacccagctgtcccacttgggccagggcacaagg
accaacgtgtatgagggccgcctgcgagtggagggcagcggggaccctgaggagggcaag
atggatgacgaggaccccctcgtgcctggcagggaccgtgggcaggagctacgagtggtg
ctcaaagtgctggaccctagtcaccatgacatcgccctggccttctacgagacagccagc
ctcatgagccaggtctcccacatgcacctggccttcgtgcatggcgtctgtgtgcgcggc
cctgaaaatatcatggtgacagagtacgtggagcacggacccctggatgtgtggctgcgg
agggagcggggccatgtgcccatggcttggaagatggtggtggcccagcagctggccagc
gccctcagctacctggagaacaagaacctggttcatggtaatgtgtgtggccggaacatc
ctgctggcccggctggggttggcagagggcaccagccccttcatcaagctgagtgatcct
ggcgtgggcctgggcgccctctccagggaggagcgggtggagaggatcccctggctggcc
cccgaatgcctaccagttggggccaacagcctaagcaccgccatggacaagtgggggttt
ggcgccaccctcctggagatctgctttgacggagaggcccctctgcagagccgcagtccc
tccgagaaggagcatttctaccagaggcagcaccggctgcccgagccctcctgcccagag
ctggccacactcaccagccagtgtctgacctatgagccaacccagaggccatcattccgc
accatcctgcgtgacctcacccggctgcagccccacactcttccagatcttgctgacgtc
ttgactgtgaacccggactcaccggcgtcggaccctacggttttccacaagcgctacttg
aaaaagatccgagatctgggcgagggtcacttcggcaaggtcagcttgtactgctacgat
ccgaccaacgacggcactggcgagatggtggcggtgaaagccctcaaggcagactgcggc
ccccagcaccgctcgggctggaagcaggagattgacattctgcgcacgctctaccacgag
cacatcatcaagtacaagggctgctgcgaggaccaaggcgagaagtcgctgcagctggtc
atggagtacgtgcccctgggcagcctccgagactacctgccccggcacagcgtcgggctg
gcccagctgctgctcttcgcccagcagatctgcgagggcatggcctatctgcacgcgcag
cactacatccaccgagacctagccgcgcgcaacgtgctgctggacaacgacaggctggtc
aagatcggggactttggcctagccaaggccgtgcccgaaggccacgagtactaccgcgtg
cgcgaggatggggacagccccgtgttctggtatgccccagagtgcctgaaggagtataag
ttctactatgcgtcagatgtctggtccttcggggtgaccctgtatgagctgctgacgcac
tgtgactccagccagagcccccccacgaaattccttgagctcataggcattgctcagggt
cagatgacagttctgagactcactgagttgctggaacgaggggagaggctgccacggccc
gacaaatgtccctgtgaggtctatcatctcatgaagaactgctgggagacagaggcgtcc
tttcgcccaaccttcgagaacctcatacccattctgaagacagtccatgagaagtaccaa
ggccaggccccttcagtgtttagcgtgtgctga

KEGG   Pan paniscus (bonobo): 100979742
Entry
100979742         CDS       T02283                                 

Gene name
JAK2
Definition
(RefSeq) Janus kinase 2
  KO
K04447  Janus kinase 2 [EC:2.7.10.2]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps04062  Chemokine signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04217  Necroptosis
pps04550  Signaling pathways regulating pluripotency of stem cells
pps04630  JAK-STAT signaling pathway
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04725  Cholinergic synapse
pps04917  Prolactin signaling pathway
pps04920  Adipocytokine signaling pathway
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps04935  Growth hormone synthesis, secretion and action
pps05140  Leishmaniasis
pps05145  Toxoplasmosis
pps05152  Tuberculosis
pps05161  Hepatitis B
pps05164  Influenza A
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05200  Pathways in cancer
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100979742 (JAK2)
   04151 PI3K-Akt signaling pathway
    100979742 (JAK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100979742 (JAK2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100979742 (JAK2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100979742 (JAK2)
   04659 Th17 cell differentiation
    100979742 (JAK2)
   04062 Chemokine signaling pathway
    100979742 (JAK2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100979742 (JAK2)
   04917 Prolactin signaling pathway
    100979742 (JAK2)
   04935 Growth hormone synthesis, secretion and action
    100979742 (JAK2)
  09156 Nervous system
   04725 Cholinergic synapse
    100979742 (JAK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100979742 (JAK2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100979742 (JAK2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100979742 (JAK2)
   05164 Influenza A
    100979742 (JAK2)
   05168 Herpes simplex virus 1 infection
    100979742 (JAK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100979742 (JAK2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100979742 (JAK2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100979742 (JAK2)
   05140 Leishmaniasis
    100979742 (JAK2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100979742 (JAK2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100979742 (JAK2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100979742 (JAK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100979742 (JAK2)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100979742 (JAK2)
Protein kinases [BR:pps01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   100979742 (JAK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl SH2 Kdo ABC1 Kinase-like RIO1
Other DBs
NCBI-GeneID: 100979742
NCBI-ProteinID: XP_003823415
UniProt: A0A2R8ZHT5
Position
9
AA seq 1132 aa
MGMACLTMTEMEGTSASSIYQNGDISGNANSMKQIDPVLQVYLYHSLGKSEADYLTFPSG
EYVAEEICIAASKACGITPVYHNMFALMSETERIWYPPNHVFHIDESTRHNVLYRIRFYF
PRWYCSGSNRAYRHGISRGAEAPLLDDFVMSYLFAQWRHDFVHGWIKVPVTHETQEECLG
MAVLDMMRIAKENDQTPLAIYNSISYKTFLPKCIRAKIQDYHILTRKRIRYRFRRFIQQF
SQCKATARNLKLKYLINLETLQSAFYTEKFEVKEPGSGPSGEEIFATIIITGNGGIQWSR
GKHKESETLTEQDLQLYCDFPNIIDVSIKQANQEGSNESRVVTIHKQDGKNLEIELSSLR
EALSFVSLIDGYYRLTADAHHYLCKEVAPPTVLENIQSNCHGPISMDFAISKLKKAGNQT
GLYVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENEEYNLSGTKKNFSSLKDLLNC
YQMETVRSDNIIFQFTKCCPPKPKDKSNLLVFRTNGVSDVPTSPTLQRPTHMNQMVFHKI
RNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASM
MSKLSHKHLVLNYGVCVCGDENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLAWA
MHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVP
PECIENPKNLNLATDKWSFGTTLWEVCSGGDKPLSALDSQRKLQFYEDRHQLPAPKWAEL
ANLINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRD
PTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIE
ILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQI
CKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFW
YAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIE
LLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
NT seq 3399 nt   +upstreamnt  +downstreamnt
atgggaatggcctgccttacgatgacagaaatggagggaacatccgcctcttctatatat
cagaatggtgatatttctggaaatgccaattctatgaagcaaatagatccagttcttcag
gtgtatctttaccattcccttgggaaatctgaggcagattatctgacctttccatccggg
gagtatgttgcagaagaaatctgtattgctgcttctaaagcttgtggtatcacacctgtg
tatcataatatgtttgctttaatgagtgaaacagaaaggatctggtatccacccaaccat
gtcttccatatagatgagtcaaccaggcataatgtactctacagaataagattttacttt
cctcgttggtactgcagtggcagcaacagagcctatcggcatggaatatctcgaggtgct
gaagctcctcttcttgatgactttgtcatgtcttacctctttgctcagtggcggcatgat
tttgtgcatggatggataaaagtacctgtgactcatgaaacacaggaagaatgtcttggg
atggcagtgttagatatgatgagaatagccaaagaaaacgatcaaaccccactggccatc
tataactctatcagctacaagacattcttaccaaaatgtattcgagcaaagatccaagac
tatcatattttgacaaggaagcgaataaggtacagatttcgcagatttattcagcaattc
agccaatgcaaagccactgccagaaacttgaaacttaagtatcttataaatctggaaact
ctgcagtctgccttctacacagagaaatttgaagtaaaagaacctggaagtggtccttca
ggtgaggagatttttgcaaccattataataactggaaacggtggaattcagtggtcaaga
gggaaacataaagaaagtgagacactgacagaacaggatttacagttatattgcgatttt
cctaatattattgatgtcagtattaagcaagcaaaccaagagggttcaaatgaaagccga
gttgtaactatccataagcaagatggtaaaaatctggaaattgaacttagctcattaagg
gaagctttgtctttcgtgtcattaattgatggatattatagattaactgcagatgcacat
cattacctctgtaaagaagtagcacctccaaccgtgcttgaaaatatacaaagcaactgt
catggcccaatttcgatggattttgccattagtaaactgaagaaagcaggtaatcagact
ggactgtatgtacttcgatgcagtcctaaggactttaataaatattttttgacatttgct
gtcgagcgagaaaatgtcattgaatataaacactgtttgattacaaaaaatgagaatgaa
gagtacaacctcagtgggacaaagaagaacttcagcagtcttaaagatcttttgaattgt
taccagatggaaactgttcgctcagacaatataattttccagtttactaaatgctgtccc
ccaaagccaaaagataaatcaaaccttctagtcttcagaacgaatggtgtttctgatgta
ccaacctcaccaacattacagaggcctactcatatgaaccaaatggtgtttcacaaaatc
agaaatgaagatttgatatttaatgaaagccttggccaaggcacttttacaaagattttt
aaaggcgtacgaagagaagtaggagactacggtcaactgcatgaaacagaagttctttta
aaagttctggataaagcacatagaaactattcagagtctttctttgaagcagcaagtatg
atgagcaagctttctcacaagcatttggttttaaattatggagtatgtgtctgtggagat
gagaatattctggttcaggagtttgtaaaatttggatcactagatacatatctgaaaaag
aataaaaattgtataaatatattatggaaacttgaagttgctaaacagttggcatgggcc
atgcattttctagaagaaaacacccttattcatgggaatgtatgtgccaaaaatattctg
cttatcagagaagaagacaggaagacaggaaatcctcctttcatcaaacttagtgatcct
ggcattagtattacagttttgccaaaggacattcttcaggagagaataccatgggtacca
cctgaatgcattgaaaatcctaaaaatttaaatttggcaacagacaagtggagttttggc
accactttgtgggaagtctgcagtggaggagataaacctctaagtgctctggattctcaa
agaaagctacaattttatgaagataggcatcagcttcctgcaccaaagtgggcagaatta
gcaaaccttataaataattgtatggattatgaaccagatttcaggccttctttcagagcc
atcatacgagatcttaacagtttgtttactccagattatgaactattaacagaaaatgac
atgttaccaaatatgaggataggtgccctagggttttctggtgcctttgaagaccgggat
cctacacagtttgaagagagacatttgaaatttctgcagcaacttggcaagggtaatttt
gggagtgtggagatgtgccggtatgaccctctacaggacaacactggggaggtggtcgct
gtaaaaaagcttcagcatagtactgaagagcacctaagagactttgaaagggaaattgaa
atcctgaaatccctacaacatgacaacattgtaaagtacaagggagtgtgctacagtgct
ggtcggcgtaatctaaaattaattatggaatatttaccatatggaagtttacgagactat
cttcaaaaacataaagaacggatagatcacataaaacttctgcagtacacatctcagata
tgcaagggtatggagtatcttggtacaaaaaggtatatccacagggatctggcaacgaga
aatatattggtggagaatgagaacagagttaaaattggagattttgggttaaccaaagtc
ttgccacaagacaaagaatactataaagtaaaagaacctggtgaaagtcccatattctgg
tatgctccagaatcactgacagagagcaagttttctgtggcctcagatgtttggagcttt
ggagtggttctgtatgaacttttcacatacattgagaagagtaaaagtccaccagcggaa
tttatgcgtatgattggcaacgacaaacaaggacagatgatcgtgttccatttgatagaa
cttttgaagaataatggaagattaccaagaccagatggatgcccagatgagatctatatg
atcatgacagaatgctggaacaataatgtaaatcaacgcccctcctttagggatctagct
cttcgagtggatcaaataagggataacatggctggatga

DBGET integrated database retrieval system