KEGG   Pan paniscus (bonobo): 100972085
Entry
100972085         CDS       T02283                                 

Gene name
STAT2
Definition
(RefSeq) signal transducer and activator of transcription 2
  KO
K11221  signal transducer and activator of transcription 2
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04062  Chemokine signaling pathway
pps04217  Necroptosis
pps04380  Osteoclast differentiation
pps04621  NOD-like receptor signaling pathway
pps04625  C-type lectin receptor signaling pathway
pps04630  JAK-STAT signaling pathway
pps05160  Hepatitis C
pps05161  Hepatitis B
pps05162  Measles
pps05164  Influenza A
pps05165  Human papillomavirus infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05171  Coronavirus disease - COVID-19
pps05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100972085 (STAT2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100972085 (STAT2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100972085 (STAT2)
   04625 C-type lectin receptor signaling pathway
    100972085 (STAT2)
   04062 Chemokine signaling pathway
    100972085 (STAT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100972085 (STAT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100972085 (STAT2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100972085 (STAT2)
   05160 Hepatitis C
    100972085 (STAT2)
   05171 Coronavirus disease - COVID-19
    100972085 (STAT2)
   05164 Influenza A
    100972085 (STAT2)
   05162 Measles
    100972085 (STAT2)
   05168 Herpes simplex virus 1 infection
    100972085 (STAT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100972085 (STAT2)
   05169 Epstein-Barr virus infection
    100972085 (STAT2)
   05165 Human papillomavirus infection
    100972085 (STAT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pps03000]
    100972085 (STAT2)
Transcription factors [BR:pps03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100972085 (STAT2)
SSDB
Motif
Pfam: STAT_alpha STAT2_C STAT_int STAT_bind SH2 CorA FAM184
Other DBs
NCBI-GeneID: 100972085
NCBI-ProteinID: XP_003824964
UniProt: A0A2R9C943
Position
12
AA seq 851 aa
MAQWEMLQNLDSPFQDQLHQLYSHSLLPVDIRQYLAVWIEDQNWQEAALGSDDSKATMLF
FHFLDQLNYECGRCSQDPESLLLQHNLRKFCRDIQPFSQDPTQLAEMIFNLLLEEKRILI
QAQRAQLEQGEPVLETPVESQQHEIESRILDLRAMMEKLVKSISQLKDQQDVFCFRYKIQ
AKGKTPSLDPHQTKEQKILQETLNELDKRRKEVLDASKALLGRLTTLIELLLPKLEEWKA
QQQKACIRAPIDHGLEQLETWFTAGAKLLFHLRQLLKELKGLSCLVSYQDDPLTKGVDLR
NAQVTELLQRLLHRAFVVETQPCMPQTPHRPLILKTGSKFTVRTRLLVRLQEGNESLTVE
VSIDRNPPQLQGFRKFNILTSNQKTLTPEKGQSQGLIWDFGYLTLVEQRSGGSGKGSNKG
PLGVTEELHIISFTVKYTYQGLKQELKTDTLPVVIISNMNQLSIAWASVLWFNLLSPNLQ
NQQFFSNPPKAPWSFLGPALSWQFSSYVGRGLNSDQLSMLRNKLFGQNCRTEDPLLSWAD
FTKRESPPGKLPFWTWLDKILELVHDHLKDLWNDGRIMGFVSRSQERRLLKKTISGTFLL
RFSESSEGGITCSWVEHQDDDKVLIYSVQPYTKEVLQSLPLTEIIRHYQLLTEENIPENP
LRFLYPRIPRDEAFGCYYQEKVNLQERRKYLKHRLIVVSNRQVDELQQPLELKPEPELES
LELELGLVPEPELSLDLEPLLKAGLDLGPELESVLESTLEPVIEPTLCMVSQTVPEPDRG
PVSQPVPEPDLPCDLRHLNTEPMEIFRNCVKIEEIMPNGDPLLAGQNTVDEVYVSRPSHF
YTDGPLMPSDF
NT seq 2556 nt   +upstreamnt  +downstreamnt
atggcgcagtgggaaatgctgcagaatcttgacagcccctttcaggatcagctgcaccag
ctttactcgcacagcctcctgcctgtggacattcgacagtacttggctgtctggattgaa
gaccagaactggcaggaagctgcacttgggagtgatgattccaaggctaccatgctattc
ttccacttcttggatcagctgaactatgagtgtggccgttgcagccaggacccagagtcc
ttgttgctgcagcacaatttgcggaaattctgccgggacattcagcccttttcccaggat
cctacccagttggctgagatgatctttaacctccttctggaagaaaaaagaattttgatc
caggctcagagggcccaattggaacaaggagagccagttctcgaaacacctgtggagagc
cagcaacatgagattgaatcccggatcctggatttaagggctatgatggagaagctggta
aaatccatcagccaactgaaagaccagcaggatgtcttctgcttccgatataagatccag
gccaaagggaagacaccctctctggacccccatcagaccaaagagcagaagattctgcag
gaaactctcaatgaactggacaaaaggagaaaggaggtgctggatgcctccaaagcacta
ctaggccgattaactaccctaatcgagctactgctgccaaagttggaggagtggaaggcc
cagcagcaaaaagcctgcatcagagctcccattgaccacgggttggaacagctggagaca
tggttcacagctggagcaaagctgttgtttcacctgaggcagctgctgaaggagctgaag
ggactgagttgcctggttagctatcaggatgaccctctgaccaaaggggtggacctacgc
aacgcccaggtcacagagttgctacagcgtctgctccacagagcctttgtggtagaaacc
cagccctgcatgccccaaactccccatcgacccctcatcctcaagactggcagcaagttc
accgtccgaacaaggctgctggtgagactccaggaaggcaatgagtcactgactgtggaa
gtctccattgacaggaatcctcctcaattacaaggcttccggaagttcaacattctgact
tcaaaccagaaaactttgacccccgagaaggggcagagtcagggtttgatttgggacttt
ggttacctgactctggtggagcaacgttcaggtggttcaggaaagggcagcaataagggg
ccactaggtgtgacagaggaactgcacatcatcagcttcacggtcaaatatacctaccag
ggtctgaagcaggagctgaaaacggacaccctccctgtggtgattatttccaacatgaac
cagctctcaattgcctgggcttcagttctctggttcaatttgctcagcccaaaccttcag
aaccagcagttcttctccaacccccccaaggccccctggagctttctgggccctgctctc
agttggcagttctcctcctatgttggccgaggcctcaactcagaccagctgagcatgctg
agaaacaagctgttcgggcagaactgtaggactgaggatccattattgtcctgggctgac
ttcactaagcgagagagccctcctggcaagttaccattctggacatggctggacaaaatt
ctggagttggtacatgaccacctgaaggatctctggaatgatggacgcatcatgggcttt
gtgagtcggagccaggagcgccggctgctgaagaagaccatctctggcacctttctactg
cgcttcagtgaatcgtcagaagggggcattacctgctcctgggtggagcaccaggatgat
gacaaggtgctcatctactctgtgcaaccgtacacgaaggaggtgctgcagtcactcccg
ctgactgaaatcatccgccattaccagttgctcactgaggagaatatacctgaaaaccca
ctgcgcttcctctatccccgaatcccccgggatgaagcttttgggtgctactaccaggag
aaagttaatctccaggaacggaggaaatacctgaaacacaggctcattgtggtctctaat
agacaggtggatgaactgcaacaacctctggagcttaagccagagccagagctggagtca
ttagagctggaactagggctggtgccagagccagagctcagcctggacttagagccactg
ctgaaggcagggctggatctggggccagagctagagtctgtgctggagtccactctggag
cctgtgatagagcccacactatgcatggtatcacaaacagtgccagagccagaccgagga
cctgtatcacagccagtgccggagccagatttgccctgtgatctgagacatttgaacact
gagccaatggaaatcttcagaaactgtgtaaagattgaagaaatcatgccgaatggtgac
ccactgttggctggccagaacaccgtggatgaggtttacgtctcccgccccagccacttc
tacactgatggacccttgatgccttctgacttctag

DBGET integrated database retrieval system