KEGG   Pan paniscus (bonobo): 100972306
Entry
100972306         CDS       T02283                                 

Gene name
GSK3B
Definition
(RefSeq) glycogen synthase kinase 3 beta
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps04012  ErbB signaling pathway
pps04062  Chemokine signaling pathway
pps04110  Cell cycle
pps04150  mTOR signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04310  Wnt signaling pathway
pps04340  Hedgehog signaling pathway
pps04360  Axon guidance
pps04390  Hippo signaling pathway
pps04510  Focal adhesion
pps04550  Signaling pathways regulating pluripotency of stem cells
pps04657  IL-17 signaling pathway
pps04660  T cell receptor signaling pathway
pps04662  B cell receptor signaling pathway
pps04722  Neurotrophin signaling pathway
pps04728  Dopaminergic synapse
pps04910  Insulin signaling pathway
pps04916  Melanogenesis
pps04917  Prolactin signaling pathway
pps04919  Thyroid hormone signaling pathway
pps04931  Insulin resistance
pps04932  Non-alcoholic fatty liver disease
pps04934  Cushing syndrome
pps04935  Growth hormone synthesis, secretion and action
pps05010  Alzheimer disease
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05135  Yersinia infection
pps05160  Hepatitis C
pps05162  Measles
pps05163  Human cytomegalovirus infection
pps05165  Human papillomavirus infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05200  Pathways in cancer
pps05210  Colorectal cancer
pps05213  Endometrial cancer
pps05215  Prostate cancer
pps05217  Basal cell carcinoma
pps05224  Breast cancer
pps05225  Hepatocellular carcinoma
pps05226  Gastric cancer
pps05415  Diabetic cardiomyopathy
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100972306 (GSK3B)
   04310 Wnt signaling pathway
    100972306 (GSK3B)
   04340 Hedgehog signaling pathway
    100972306 (GSK3B)
   04390 Hippo signaling pathway
    100972306 (GSK3B)
   04151 PI3K-Akt signaling pathway
    100972306 (GSK3B)
   04150 mTOR signaling pathway
    100972306 (GSK3B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100972306 (GSK3B)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100972306 (GSK3B)
   04550 Signaling pathways regulating pluripotency of stem cells
    100972306 (GSK3B)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100972306 (GSK3B)
   04657 IL-17 signaling pathway
    100972306 (GSK3B)
   04662 B cell receptor signaling pathway
    100972306 (GSK3B)
   04062 Chemokine signaling pathway
    100972306 (GSK3B)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100972306 (GSK3B)
   04917 Prolactin signaling pathway
    100972306 (GSK3B)
   04935 Growth hormone synthesis, secretion and action
    100972306 (GSK3B)
   04919 Thyroid hormone signaling pathway
    100972306 (GSK3B)
   04916 Melanogenesis
    100972306 (GSK3B)
  09156 Nervous system
   04728 Dopaminergic synapse
    100972306 (GSK3B)
   04722 Neurotrophin signaling pathway
    100972306 (GSK3B)
  09158 Development and regeneration
   04360 Axon guidance
    100972306 (GSK3B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100972306 (GSK3B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100972306 (GSK3B)
   05225 Hepatocellular carcinoma
    100972306 (GSK3B)
   05226 Gastric cancer
    100972306 (GSK3B)
   05217 Basal cell carcinoma
    100972306 (GSK3B)
   05215 Prostate cancer
    100972306 (GSK3B)
   05213 Endometrial cancer
    100972306 (GSK3B)
   05224 Breast cancer
    100972306 (GSK3B)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100972306 (GSK3B)
   05162 Measles
    100972306 (GSK3B)
   05163 Human cytomegalovirus infection
    100972306 (GSK3B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100972306 (GSK3B)
   05165 Human papillomavirus infection
    100972306 (GSK3B)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100972306 (GSK3B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100972306 (GSK3B)
   05020 Prion disease
    100972306 (GSK3B)
   05022 Pathways of neurodegeneration - multiple diseases
    100972306 (GSK3B)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100972306 (GSK3B)
   05415 Diabetic cardiomyopathy
    100972306 (GSK3B)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100972306 (GSK3B)
   04931 Insulin resistance
    100972306 (GSK3B)
   04934 Cushing syndrome
    100972306 (GSK3B)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100972306 (GSK3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100972306 (GSK3B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pps03036]
    100972306 (GSK3B)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     100972306 (GSK3B)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   100972306 (GSK3B)
Chromosome and associated proteins [BR:pps03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100972306 (GSK3B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kinase-like APH Kdo
Other DBs
NCBI-GeneID: 100972306
NCBI-ProteinID: XP_003825207
UniProt: A0A2R9C6C8
Position
3
AA seq 420 aa
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALF
NFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgtcagggcggcccagaaccacctcctttgcggagagctgcaagccggtgcagcagcct
tcagcttttggcagcatgaaagttagcagagacaaggacggcagcaaggtgacaacagtg
gtggcaactcctgggcagggtccagacaggccacaagaagtcagctatacagacactaaa
gtgattggaaatggatcatttggtgtggtatatcaagccaaactttgtgattcaggagaa
ctggtcgccatcaagaaagtattgcaggacaagagatttaagaatcgagagctccagatc
atgagaaagctagatcactgtaacatagtccgattgcgttatttcttctactccagtggt
gagaagaaagatgaggtctatcttaatctggtgctggactatgttccggaaacagtatac
agagttgccagacactatagtcgagccaaacagacgctccctgtgatttatgtcaagttg
tatatgtatcagctgttccgaagtttagcctatatccattcctttggaatctgccatcgg
gatattaaaccgcagaacctcttgttggatcctgatactgctgtattaaaactctgtgac
tttggaagtgcaaagcagctggtccgaggagaacccaatgtttcgtatatctgttctcgg
tactatagggcaccagagttgatctttggagccactgattatacctctagtatagatgta
tggtctgctggctgtgtgttggctgagctgttactaggacaaccaatatttccaggggat
agtggtgtggatcagttggtagaaataatcaaggtcctgggaactccaacaagggagcaa
atcagagaaatgaacccaaactacacagaatttaaattccctcaaattaaggcacatcct
tggactaaggtcttccgaccccgaactccaccggaggcaattgcactgtgtagccgtctg
ctggagtatacaccaactgcccgactaacaccactggaagcttgtgcacattcatttttt
gatgaattacgggacccaaatgtcaaactaccaaatgggcgagacacacctgcactcttc
aacttcaccactcaagaactgtcaagtaatccacctctggctaccatccttattcctcct
catgctcggattcaagcagctgcttcaacccccacaaatgccacagcagcctcagatgct
aatactggagaccgtggacagaccaataatgctgcttctgcatcagcttccaactccacc
tga

DBGET integrated database retrieval system