KEGG   Pan paniscus (bonobo): 100972410Help
Entry
100972410         CDS       T02283                                 

Gene name
FIS1
Definition
(RefSeq) fission, mitochondrial 1
  KO
K17969  mitochondrial fission 1 protein
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04137  Mitophagy - animal
Brite
KEGG Orthology (KO) [BR:pps00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100972410 (FIS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pps03029]
    100972410 (FIS1)
Mitochondrial biogenesis [BR:pps03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    100972410 (FIS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fis1_TPR_C Fis1_TPR_N ANAPC3 TPR_2 TPR_15 COPI_C DUF2481
Motif
Other DBs
NCBI-GeneID: 100972410
NCBI-ProteinID: XP_008957494
UniProt: A0A2R9BAE7
Position
7
AA seq 152 aa AA seqDB search
MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEE
LLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKK
DGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggaggccgtgctgaacgagctggtgtctgtggaggacctgctgaagtttgaaaagaaa
tttcagtctgagaaggcagcaggctcggtgtccaagagcacgcagtttgagtacgcctgg
tgcctggtgcggagcaagtacaatgatgacatccgtaaaggcatcgtgctgctcgaggag
ctgctgcccaaagggagcaaggaggaacagcgggattacgtcttctacctggccgtgggg
aactaccggctcaaggaatacgagaaggccttaaagtacgtccgcgggttgctgcagaca
gagccccagaacaaccaggccaaggaactggagcggctcattgacaaggccatgaagaaa
gatggactcgtgggcatggccatcgtgggaggcatggccctgggtgtggcgggactggcc
ggactcatcggacttgctgtgtccaagtccaaatcctga

DBGET integrated database retrieval system