KEGG   Pan paniscus (bonobo): 100972637
Entry
100972637         CDS       T02283                                 

Gene name
CD247
Definition
(RefSeq) CD247 molecule
  KO
K06453  CD3Z antigen, zeta polypeptide
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04650  Natural killer cell mediated cytotoxicity
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04660  T cell receptor signaling pathway
pps05142  Chagas disease
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100972637 (CD247)
   04660 T cell receptor signaling pathway
    100972637 (CD247)
   04658 Th1 and Th2 cell differentiation
    100972637 (CD247)
   04659 Th17 cell differentiation
    100972637 (CD247)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100972637 (CD247)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100972637 (CD247)
   05169 Epstein-Barr virus infection
    100972637 (CD247)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100972637 (CD247)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100972637 (CD247)
   04090 CD molecules [BR:pps04090]
    100972637 (CD247)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100972637 (CD247)
CD molecules [BR:pps04090]
 Proteins
  100972637 (CD247)
SSDB
Motif
Pfam: ITAM TCR_zetazeta
Other DBs
NCBI-GeneID: 100972637
NCBI-ProteinID: XP_003824647
Position
1
AA seq 164 aa
MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSAD
APAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMA
EAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
NT seq 495 nt   +upstreamnt  +downstreamnt
atgaagtggaaggcgcttttcaccgcggccatcctgcaggcacagttgccgattacagag
gcacagagctttggcctgctggatcccaaactctgctacctgctggatggaatcctcttc
atctatggtgtcattctcactgccctgttcctgagagtgaagttcagcaggagcgcagac
gcccccgcgtaccagcagggccagaaccagctctataacgagctcaatctaggacgaaga
gaggagtacgatgttttggacaagagacgtggccgggaccctgagatggggggaaagccg
cagagaaggaagaaccctcaggaaggcctgtacaacgaactgcagaaagataagatggcg
gaggcctacagtgagattgggatgaaaggcgagcgccggaggggcaaggggcacgatggc
ctttaccagggtctcagtacagccaccaaggacacctacgacgcccttcacatgcaggcc
ctgccccctcgctaa

DBGET integrated database retrieval system