KEGG   Pan paniscus (bonobo): 100972767
Entry
100972767         CDS       T02283                                 

Gene name
TSHR
Definition
(RefSeq) thyroid stimulating hormone receptor
  KO
K04249  thyrotropin receptor
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04024  cAMP signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04918  Thyroid hormone synthesis
pps04923  Regulation of lipolysis in adipocytes
pps05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100972767 (TSHR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100972767 (TSHR)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100972767 (TSHR)
   04918 Thyroid hormone synthesis
    100972767 (TSHR)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100972767 (TSHR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100972767 (TSHR)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Peptide
   Thyrotropin
    100972767 (TSHR)
SSDB
Motif
Pfam: 7tm_1 LRR_8 LRR_5 7TM_GPCR_Srx SSFA2_C
Other DBs
NCBI-GeneID: 100972767
NCBI-ProteinID: XP_003808943
UniProt: A0A2R9C1V5
Position
14
AA seq 764 aa
MRPADLLQLVLLLDLPRDLGGMGCSSPPCECHQEEDFRVTCKDIQRIPNLPPSTQTLKLI
ETHLRTIPSHAFSNLPNISRIYVSIDVTLQQLESHSFYNLSKVTHIEIRNTRNLTYIDPD
ALKELPLLKFLGIFNTGLKMFPDLTKVYSTDIFFILEITDNPYMTSIPVNAFQGLCNETL
TLKLYNNGFTSVQGYAFNGTKLDAVYLNKNKYLTVIDKDAFGGVYSGPSLLDVSQTSVTA
LPSKGLEHLKELIARNTWTLKKLPLSLSFLHLTRADLSYPSHCCAFKNQKKIRGILESLM
CNESSMQSLRQRKSVNALNSPLHQEYEENLGDSIVGYKEKSKFQDTRNNAHYYIFFEEQE
DEIIGFGQELKNPQEETLQAFDSHYDYTVCGDSEDMVCTPKSDEFNPCEDIMGYKFLRIV
VWFVSLLALLGNVFVLLILLTSHYKLNVPRFLMCNLAFADFCMGMYLLLIASVDLYTHSE
YYNHAIDWQTGPGCNTAGFFTVFASELSVYTLTVITLERWYAITFAMRLDRKIRLRHACA
IMVGGWVCCFLLALLPLVGISSYAKVSICLPMDTETPLALAYIVFVLTLNIVAFVIVCCC
YVKIYITVRNPQYNPGDKDTKIAKRMAVLIFTDFMCMAPISFYALSAILNKPLITVSNSK
ILLVLFYPLNSCANPFLYAIFTKAFQRDVFILLSKFGICKRQAQAYRGQRVPPKNSTDIQ
VQKVTHDMRQGLHNMQDVYELLENSHLTPKKQGQISEEYMQTVL
NT seq 2295 nt   +upstreamnt  +downstreamnt
atgaggccggcggacttgctgcagctggtgctgctgctcgacctgcccagggacctgggc
ggaatggggtgttcgtctccaccctgcgagtgccatcaggaggaggacttcagagtcacc
tgcaaggatattcaacgcatccccaacttaccgcccagtacgcagactctgaagcttatt
gagactcacctgagaactattccaagtcatgcattttctaatctgcccaatatttccaga
atctacgtatctatagatgtgactctgcagcagctggaatcacactccttctacaatttg
agtaaagtgactcacatagaaattcggaataccaggaacttaacttacatagaccctgat
gccctcaaagagctccccctcctaaagttccttggcattttcaacactggacttaaaatg
ttccctgacctaaccaaagtttattccactgatatattctttatacttgaaattacagac
aacccttacatgacgtcaatccctgtgaatgcttttcagggactatgcaatgaaaccttg
acgctgaagctgtacaacaacggctttacttcagtccaaggatatgctttcaatgggaca
aagctggatgctgtttacctaaacaagaataaatacctgacagttattgacaaagatgca
tttggaggagtatacagtggaccaagcttgctggacgtgtctcaaaccagtgtcactgcc
cttccatccaaaggcctggagcacctgaaggaactgatagcaagaaacacctggactctt
aagaaacttccactttccttgagtttccttcacctcacacgggctgacctttcttaccca
agccactgctgtgcttttaagaatcaaaagaaaatcagaggaatccttgagtccttgatg
tgtaatgagagcagcatgcagagcttgcgccagaggaaatctgtgaatgccttgaatagc
cccctccaccaggaatatgaagagaatctgggtgacagcattgttgggtacaaggaaaag
tccaagttccaggatactcgtaacaacgctcattattacatcttctttgaagaacaagag
gatgagatcattggttttggccaagagctcaaaaacccccaggaagagactctacaagct
tttgacagccattatgactacactgtgtgtggggacagtgaagacatggtgtgtaccccc
aagtccgatgagttcaacccgtgtgaagacataatgggctacaagttcctgagaattgtg
gtgtggttcgttagtctgctggctctcctgggcaatgtctttgtcctgcttattctcctc
accagccactacaaactgaatgtcccccgctttctcatgtgcaacctggcctttgcggat
ttctgcatggggatgtacctgctcctcatcgcctctgtagacctctacactcactctgag
tactacaaccatgccatcgactggcagacaggccctgggtgcaacacggctggtttcttc
actgtctttgcgagcgagttatcggtgtatacactgacggtcatcaccctggagcgctgg
tatgccatcaccttcgccatgcgcctggaccggaagatccgcctcaggcacgcatgtgcc
atcatggttgggggctgggtttgctgcttccttctcgccctgcttcctttggtgggaata
agtagctatgccaaagtcagtatctgcctgcccatggacaccgagacccctcttgctctg
gcatatattgtttttgttctgacgctcaacatagttgccttcgtcatcgtctgctgctgt
tatgtgaagatctacatcacagtcagaaatccgcagtacaacccaggggacaaagatacc
aaaattgccaagaggatggctgtgttgatcttcaccgacttcatgtgcatggccccaatc
tcattctatgctctgtcagcaattctgaacaagcctctcatcactgttagcaactccaaa
atcttgctggtactcttctatccacttaactcctgtgccaatccattcctctatgctatt
ttcaccaaggccttccagagggatgtgttcatcctactcagcaagtttggcatctgtaaa
cgccaggctcaggcataccgggggcagagggttcctccaaagaacagcactgatattcag
gttcaaaaggttacccacgacatgaggcagggtctccacaacatgcaagatgtctatgaa
ctgcttgaaaactcccatctaaccccaaagaagcaaggccaaatatcagaagagtatatg
caaacggttttgtaa

DBGET integrated database retrieval system