KEGG   Pan paniscus (bonobo): 100972895
Entry
100972895         CDS       T02283                                 

Gene name
STAT4
Definition
(RefSeq) signal transducer and activator of transcription 4
  KO
K11222  signal transducer and activator of transcription 4
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04217  Necroptosis
pps04630  JAK-STAT signaling pathway
pps04658  Th1 and Th2 cell differentiation
pps05161  Hepatitis B
pps05200  Pathways in cancer
pps05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100972895 (STAT4)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100972895 (STAT4)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100972895 (STAT4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100972895 (STAT4)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100972895 (STAT4)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100972895 (STAT4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pps03000]
    100972895 (STAT4)
Transcription factors [BR:pps03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100972895 (STAT4)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind SH2 CRC_subunit NPV_P10
Other DBs
NCBI-GeneID: 100972895
NCBI-ProteinID: XP_003825335
Position
2B
AA seq 748 aa
MSQWNQVQQLEIKFLEQVDQFYDDNFPMEIRHLLAQWIENQDWEAASNNETMATILLQNL
LIQLDEQLGRVSKEKNLLLIHNLKRIRKVLQGKFHGNPMHVAVVISNCLREERRILAAAN
MPVQGPLEKSLQSSSVSERQRNVEHKVAAIKNSVQMTEQDTKYLEDLQDEFDYRYKTIQT
MDQSDKNSAMVNQEVLTLQEMLNSLDFKRKEALSKMTQIIHETDLLMNTMLIEELQDWKR
RQQIACIGGPLHNGLDQLQNCFTLLAESLFQLRRQLEKLEEQSTKMTYEGDPIPMQRTHM
LERVTFLIYNLFKNSFVVERQPCMPTHPQRPLVLKTLIQFTVKLRLLIKLPELNYQVKVK
ASIDKNVSTLSNRRFVLCGTNVKAMSIEESSNGSLSVEFRHLQPKEMKSSAGGKGNEGCH
MVTEELHSITFETQICLYGLTIDLETSSLPVVMISNVSQLPNAWASIIWYNVSTNDSQNL
VFFNNPPPATLSQLLEVMSWQFSSYVGRGLNSDQLHMLAEKLTVQSSYSDGHLTWAKFCK
EHLPGKSFTFWTWLEAILDLIKKHILPLWIDGYVMGFVSKEKERLLLKDKMPGTFLLRFS
ESHLGGITFTWVDHSESGEVRFHSVEPYNKGRLSALPFADILRDYKVIMAENIPENPLKY
LYPDIPKDKAFGKHYSSQPCEVSRPTERGDKGYVPSVFIPISTIRSDSTEPHSPSDLLPM
SPSVYAVLRENLSPTTIETAMKSPYSAE
NT seq 2247 nt   +upstreamnt  +downstreamnt
atgtctcagtggaatcaagtccaacagttagaaatcaagtttttggagcaggtggatcaa
ttctatgatgacaactttcccatggaaattcggcatctgttggcccagtggattgaaaat
caagactgggaggcagcttctaacaatgaaaccatggcaacgattcttcttcaaaacttg
ttaatacaactggatgaacagttaggtcgtgtttccaaagagaaaaacctactcttgata
cacaatctaaaaagaattaggaaggtccttcagggaaaatttcatggaaatccaatgcat
gtagctgtggttatttcaaactgtttaagggaagagaggagaatattggctgcagccaac
atgcctgtccaggggcctctagagaaatccttacaaagttcttcagtttcagaaagacag
aggaatgtggagcacaaagtggctgccattaaaaacagtgtgcagatgacagaacaagat
accaaatacttagaagatctgcaagacgaatttgactacaggtataaaacaattcagaca
atggatcagagtgacaagaatagtgccatggtgaatcaggaagttttgacactgcaggaa
atgcttaacagcctcgatttcaagagaaaggaggctctcagtaaaatgacccaaatcatc
catgagacagacctgttaatgaacaccatgctcatagaagagctgcaagactggaagcgg
cggcagcaaatagcctgcatcgggggtccactccacaatgggctcgaccagcttcagaac
tgctttacactattggcagaaagtcttttccaactgagaaggcaattggagaaactagag
gagcaatctaccaaaatgacatatgaaggtgatcccattccaatgcaaagaactcacatg
ctagaaagagtcaccttcttgatctacaaccttttcaagaactcatttgtggttgagcga
cagccatgtatgccaacccaccctcagaggccgttggtacttaaaaccctaattcagttc
actgtaaaactaaggctactaataaaattgccagaactaaactatcaggtaaaggttaag
gcatcaattgacaagaatgtttcaactctaagcaaccgaagatttgtactttgtggaact
aatgtcaaagccatgtctattgaagaatcttccaatgggagtctctcagtagaatttcga
catttgcaaccaaaggaaatgaagtccagtgctggaggtaaaggaaatgagggctgtcac
atggtgactgaagaacttcattccataacatttgaaacacagatctgcctctatggcctg
accatagatttggagaccagctcattgcctgtggtgatgatttccaatgtcagtcagtta
cctaatgcttgggcatccatcatttggtacaacgtgtcaaccaacgattcccagaacttg
gttttctttaataatcctccacctgccacattgagtcaactactggaggtgatgagctgg
cagttttcatcgtacgttggtcgtggtcttaactcagatcaactccatatgctggcagag
aagcttacagtccaatctagctacagtgatggtcacctcacctgggccaagttctgcaag
gaacatttacctggtaaatcatttaccttttggacatggcttgaagcaatattggatcta
attaagaaacacattcttcccctttggattgatgggtatgtcatgggctttgttagcaaa
gagaaggaacggctgttgctaaaggataaaatgcctggcacctttttattaagattcagt
gaaagccatctcggaggaataactttcacctgggtggaccattctgaaagtggggaagtg
agattccactctgtagaaccctacaataaaggccggttgtctgctctgccattcgctgac
atcctgcgagactacaaagttattatggctgaaaacattcctgaaaaccctctgaagtat
ctatatcctgacattcccaaagacaaagccttcggtaaacactacagctctcagccttgc
gaagtttcaagaccaacagaaaggggtgacaaaggttatgttccttctgtttttatcccc
atctcaacaatccgaagtgattcaacggagccacattctccatcagaccttcttcccatg
tctccaagtgtgtatgcggtgttgagagaaaacctgagtcccacaacaattgaaactgca
atgaagtctccttattctgctgaatga

DBGET integrated database retrieval system