KEGG   Pan paniscus (bonobo): 100972953Help
Entry
100972953         CDS       T02283                                 

Gene name
SOS1
Definition
(RefSeq) SOS Ras/Rac guanine nucleotide exchange factor 1
  KO
K03099  son of sevenless
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps01522  Endocrine resistance
pps04010  MAPK signaling pathway
pps04012  ErbB signaling pathway
pps04014  Ras signaling pathway
pps04062  Chemokine signaling pathway
pps04068  FoxO signaling pathway
pps04072  Phospholipase D signaling pathway
pps04150  mTOR signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04510  Focal adhesion
pps04540  Gap junction
pps04630  Jak-STAT signaling pathway
pps04650  Natural killer cell mediated cytotoxicity
pps04660  T cell receptor signaling pathway
pps04662  B cell receptor signaling pathway
pps04664  Fc epsilon RI signaling pathway
pps04714  Thermogenesis
pps04722  Neurotrophin signaling pathway
pps04810  Regulation of actin cytoskeleton
pps04910  Insulin signaling pathway
pps04912  GnRH signaling pathway
pps04915  Estrogen signaling pathway
pps04917  Prolactin signaling pathway
pps04926  Relaxin signaling pathway
pps05034  Alcoholism
pps05160  Hepatitis C
pps05165  Human papillomavirus infection
pps05200  Pathways in cancer
pps05205  Proteoglycans in cancer
pps05206  MicroRNAs in cancer
pps05210  Colorectal cancer
pps05211  Renal cell carcinoma
pps05213  Endometrial cancer
pps05214  Glioma
pps05215  Prostate cancer
pps05220  Chronic myeloid leukemia
pps05221  Acute myeloid leukemia
pps05223  Non-small cell lung cancer
pps05224  Breast cancer
pps05225  Hepatocellular carcinoma
pps05226  Gastric cancer
pps05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100972953 (SOS1)
   04010 MAPK signaling pathway
    100972953 (SOS1)
   04012 ErbB signaling pathway
    100972953 (SOS1)
   04630 Jak-STAT signaling pathway
    100972953 (SOS1)
   04068 FoxO signaling pathway
    100972953 (SOS1)
   04072 Phospholipase D signaling pathway
    100972953 (SOS1)
   04151 PI3K-Akt signaling pathway
    100972953 (SOS1)
   04150 mTOR signaling pathway
    100972953 (SOS1)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100972953 (SOS1)
   04540 Gap junction
    100972953 (SOS1)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100972953 (SOS1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    100972953 (SOS1)
   04660 T cell receptor signaling pathway
    100972953 (SOS1)
   04662 B cell receptor signaling pathway
    100972953 (SOS1)
   04664 Fc epsilon RI signaling pathway
    100972953 (SOS1)
   04062 Chemokine signaling pathway
    100972953 (SOS1)
  Endocrine system
   04910 Insulin signaling pathway
    100972953 (SOS1)
   04912 GnRH signaling pathway
    100972953 (SOS1)
   04915 Estrogen signaling pathway
    100972953 (SOS1)
   04917 Prolactin signaling pathway
    100972953 (SOS1)
   04926 Relaxin signaling pathway
    100972953 (SOS1)
  Nervous system
   04722 Neurotrophin signaling pathway
    100972953 (SOS1)
  Environmental adaptation
   04714 Thermogenesis
    100972953 (SOS1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100972953 (SOS1)
   05231 Choline metabolism in cancer
    100972953 (SOS1)
   05206 MicroRNAs in cancer
    100972953 (SOS1)
   05205 Proteoglycans in cancer
    100972953 (SOS1)
   05210 Colorectal cancer
    100972953 (SOS1)
   05225 Hepatocellular carcinoma
    100972953 (SOS1)
   05226 Gastric cancer
    100972953 (SOS1)
   05214 Glioma
    100972953 (SOS1)
   05221 Acute myeloid leukemia
    100972953 (SOS1)
   05220 Chronic myeloid leukemia
    100972953 (SOS1)
   05211 Renal cell carcinoma
    100972953 (SOS1)
   05215 Prostate cancer
    100972953 (SOS1)
   05213 Endometrial cancer
    100972953 (SOS1)
   05224 Breast cancer
    100972953 (SOS1)
   05223 Non-small cell lung cancer
    100972953 (SOS1)
  Substance dependence
   05034 Alcoholism
    100972953 (SOS1)
  Infectious diseases
   05160 Hepatitis C
    100972953 (SOS1)
   05163 Human cytomegalovirus infection
    100972953 (SOS1)
   05165 Human papillomavirus infection
    100972953 (SOS1)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100972953 (SOS1)
   01522 Endocrine resistance
    100972953 (SOS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH PH_10 IQ_SEC7_PH PH_13
Motif
Other DBs
NCBI-GeneID: 100972953
NCBI-ProteinID: XP_003817680
Position
2A
AA seq 1333 aa AA seqDB search
MQAQQLPYEFFSEENAPKWRGLLVPALKKVQGQVHPTLESNDDALQYVEELILQLLNMLC
QAQPRSASDVEERVQKSFPHPIDKWAIADAQSAIEKRKRRNPLSLPVEKIHPLLKEVLGY
KIDHQVSVYIVAVLEYISADILKLVGNYVRNIRHYEITKQDIKVAMCADKVLMDMFHQDV
EDINILSLTDEEPSTSGEQTYYDLVKAFMAEIRQYIRELNLIIKVFREPFVSNSKLFSAN
DVENIFSRIVDIHELSVKLLGHIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYESYAR
DILRPGFHDRFLSQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQL
EEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIK
KMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRL
PGASNAEYRLKEKFFMRKVQINDKDDTNEYKHAFEIILKDENSVIFSAKSAEEKNNWMAA
LISLQYRSTLERMLDVTMLQEEKEEQMRLPSADVYRFAEPDSEENIIFEENMQPKAGIPI
IKAGTVIKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLIIERFEIPEPEPTEADR
IAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDAYLLQRMEEFIGT
VRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPTVEWHISRPGHIETFDLLTLH
PIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIV
ETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQKKI
LEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLKRHGKELINFSK
RRKVAEITGEIQQYQNQPYCLRVESDIKRFFENLNPMGNSMEKEFTDYLFNKSLEIEPRN
PKPLPRFPKKYSYPLKSPGVRPSNPRPGTMRHPTPLQQEPRKISYSRIPESETESTASAP
NSPRTPLTPPPASGASSTTDVCSVFDSDHSSPFHSSNDTVFIQVTLPHGPRSASVSSISL
TKGTEEVPVPPPVPPRRRPESAPAESSPSKIMSKHLDSPPAIPPRQPTSKAYSPRYSLSD
RTSISDPPESPPLLPPREPVRTPDVFSSSPLHLQPPPLGKKSDHGNAFFPNSPSPFTPPP
PQTPSPHGTRRHLPSPPLTQEVDLHSIAGPPVPPRQSTSQHIPKLPPKTYKREHTHPSMH
RDGPPLLENAHSS
NT seq 4002 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcgcagcagctgccctacgagtttttcagcgaagagaacgcgcccaagtggcgg
ggactgctggtgcctgcgctgaaaaaggtccaggggcaagttcatcctactctcgagtct
aatgatgatgctcttcagtatgttgaagaattaattttgcaattattaaatatgctatgc
caagctcagccccgaagtgcttcagatgtagaggaacgtgttcaaaaaagtttccctcat
ccaattgataaatgggcaatagctgatgcccaatcagctattgaaaagaggaagcgaaga
aaccctttatctctcccagtagaaaaaattcatcctttattaaaggaggtcctaggttat
aaaattgaccaccaggtttctgtttacatagtagcagtcttagaatacatttctgcagac
attttaaagctggttgggaattatgtaagaaatatacggcattatgaaattacaaaacaa
gatattaaagtggcaatgtgtgctgacaaggtattgatggatatgtttcatcaagatgta
gaagatattaatatattatctttaactgatgaagagccttccacctcaggagaacaaact
tactatgatttggtaaaagcatttatggcagaaattcgacaatatataagggaactaaat
ctaattataaaagtttttagagagccctttgtctccaattcaaaattgttttcagctaat
gatgtagaaaatatatttagtcgcatagtagatatacatgaacttagtgtaaagttactg
ggccatatagaagatacagtagaaatgacagatgaaggcagtccccatccactagtagga
agctgctttgaagacttagcagaggaactggcatttgatccatatgaatcgtatgctcga
gatattttgcgacctggttttcatgatcgtttccttagtcagttatcaaagcctggggca
gcactttatttgcagtcaataggcgaaggtttcaaagaagctgttcaatatgttttaccc
aggctgcttctggcccctgtttaccactgtctccattactttgaacttttgaagcagtta
gaagaaaaaagtgaagatcaagaagacaaggaatgtttaaaacaagcaataacagctttg
cttaatgttcagagtggtatggaaaaaatatgttctaaaagtcttgcaaaacgaagactg
agtgaatctgcatgtcggttttatagtcagcaaatgaaggggaaacaactagcaatcaag
aaaatgaacgagattcagaagaatattgatggttgggagggaaaagacattggacagtgt
tgtaatgaatttataatggaaggaactcttacacgtgtaggagccaaacacgagagacac
atatttctctttgatggcttaatgatttgctgtaaatcaaatcacgggcagccaagactt
cctggtgctagcaatgcagaatatcgtcttaaagaaaagttttttatgcgaaaggtacaa
attaatgataaagatgacaccaatgaatacaagcatgcttttgaaataattttaaaagat
gaaaatagtgttatattttctgccaagtcagctgaagagaaaaacaattggatggcagca
ttgatatctttacagtaccggagtacactggaaaggatgcttgatgtaacaatgctacag
gaagagaaagaggagcagatgaggctgcctagtgctgatgtttatagatttgcagagcct
gactctgaagagaatattatatttgaagagaacatgcagcccaaggctggaattccaatt
atcaaagcaggaactgttattaaacttatagagaggcttacgtaccatatgtacgcagat
cccaattttgttcggacatttcttacaacatacagatccttttgcaaacctcaagaacta
ctgagtcttataatagaaaggtttgaaattccagagcctgagccaacagaagctgatcgc
atagctatagagaatggagatcaacccttgagtgcagaactgaaaagatttagaaaagaa
tatatacagcctgtgcaactgcgagtattaaatgtatgtcggcactgggtagagcaccac
ttctatgattttgaaagagatgcatatcttttgcaacgaatggaagaatttattggaaca
gtaagaggtaaagcaatgaaaaaatgggttgaatccatcactaaaataatccaaaggaaa
aaaattgcaagagacaatggaccaggtcataatattacatttcagagttcacctcccaca
gttgagtggcatataagcagacctgggcacatagagacttttgacctgctcaccttacac
ccaatagaaattgctcgacaactcactttacttgaatcagatctataccgagctgtacag
ccatcagaattagttggaagtgtgtggacaaaagaagacaaagaaattaactctcctaat
cttctgaaaatgattcgacataccaccaacctcactctgtggtttgagaaatgtattgta
gaaactgaaaatttagaagaaagagtagctgtggtgagtcgaattattgagattctacaa
gtctttcaagagttgaacaactttaatggtgtccttgaggttgtcagtgctatgaattca
tcacctgtttacagactagaccacacatttgagcaaataccaagtcgccagaagaaaatt
ttagaagaagctcatgaattgagtgaagatcactataagaaatatttggcaaaactcagg
tctattaatccaccatgtgtgcctttctttggaatttatctcactaatatcttgaaaaca
gaagaaggcaaccctgaggtcctaaaaagacatggaaaagagcttataaactttagcaaa
aggaggaaagtagcagaaataacaggagagatccagcagtaccaaaatcagccttactgt
ttacgagtagaatcagatatcaaaaggttctttgaaaacttgaatccgatgggaaatagc
atggagaaggaatttacagattatcttttcaacaaatccctagaaatagaaccacgaaac
cctaagcctctcccaagatttccaaaaaaatatagctatcccctaaaatctcctggtgtt
cgtccatcaaacccaagaccaggtaccatgaggcatcccacacctctgcagcaggagcca
aggaaaattagttatagtaggatccctgaaagtgaaacagaaagtacagcatctgcacca
aattctccaagaacaccgttaacacctccgcctgcttctggtgcttccagtaccacagat
gtttgcagtgtatttgattccgatcattcgagcccttttcactcaagcaatgataccgtc
tttatccaagttactctgccccatggcccaagatctgcttctgtatcatctataagttta
accaaaggcactgaggaagtgcctgtccctcctcctgttcctccacgaagacgaccagaa
tctgccccagcagaatcttcaccatctaagattatgtctaagcatttggacagtccccca
gccattcctcctaggcaacccacatcaaaagcctattcaccacgatattcactatcagac
cggacctctatctcagaccctcctgaaagccctcccttattaccaccacgagaacctgtg
aggacacctgatgttttctcaagctcaccactacatctccaacctccccctttgggcaaa
aaaagtgaccatggcaatgccttcttcccaaacagcccttccccctttacaccacctcct
cctcaaacaccttctcctcacggcacaagaaggcatctgccatcaccaccattgacacaa
gaagtggaccttcattccattgctgggccgcctgttcctccacgacaaagcacttctcaa
catatccctaaactccctccaaaaacttacaaaagagagcacacacacccatccatgcac
agagatggaccaccactgttggagaatgcccattcttcctga

DBGET integrated database retrieval system