KEGG   Pan paniscus (bonobo): 100973407Help
Entry
100973407         CDS       T02283                                 

Gene name
WBSCR28
Definition
(RefSeq) Williams-Beuren syndrome chromosome region 28
Organism
pps  Pan paniscus (bonobo)
SSDB OrthologParalogGFIT
Motif
Pfam: WBS28
Motif
Other DBs
NCBI-GeneID: 100973407
NCBI-ProteinID: XP_003815608
UniProt: A0A2R9BP54
Position
7
AA seq 265 aa AA seqDB search
MEALPPVRSSLLGILLQVMRLSVLLVQNRDHLYNFLLLKINLFNHWVSGLAQEARGSCNW
QAHLPLGAAACPLGQALRAGLALIQVPVWLVLQGPRLMWAGMWGSTKGLGLALLSAWEQL
GLSVAIWTDRFLSCLHSLMLVALLLVVVTWRVCQKSHCFRLGRQLSKALQVNCVVRKLLA
QLRRLYWWVETMTALTSWHLAYLITWTTCLASHLLQAAFEHTTQLAEAQEVEPQEVSGSS
LLPSLSASSDSESGTVLPEQETPRE
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggaggcccttcctccagtcagatccagccttttggggattctgttgcaggttatgagg
ctctcagtgctgttggttcagaaccgagatcacctctataatttcctgctcctcaagatc
aacctcttcaaccactgggtgtcagggctggcccaggaggcccgggggtcctgtaactgg
caggcccacctacccctgggagctgcagcctgccccctgggccaggctctccgggctggg
ctggctctgatacaggtccccgtgtggctggtgctacagggacccaggctgatgtgggct
ggcatgtggggcagcaccaagggcctgggcctggccttgctcagtgcctgggagcagctg
ggcctgtctgtggccatctggacagaccggtttttgtcatgtctgcatagcctgatgttg
gtggccttgctcttggtggtagtgacctggagggtgtgtcagaagtcccactgcttccga
ctgggcaggcagctcagtaaggccttgcaagtgaactgcgtggtgaggaagctcctggca
cagctgagacgtctgtattggtgggtggagactatgactgccctcacctcctggcacctg
gcctatctcatcacctggaccacctgcctggcctcccacctgctgcaggctgcctttgag
cacacgacccagctggccgaggcccaggaggttgaaccccaggaggtctcagggtcttcc
ttgctgccctcactgtctgcgtcctcggactcagagtctggaacagttttgccagagcaa
gaaactcccagagaataa

DBGET integrated database retrieval system