KEGG   Pan paniscus (bonobo): 100973901
Entry
100973901         CDS       T02283                                 

Gene name
MADCAM1
Definition
(RefSeq) mucosal vascular addressin cell adhesion molecule 1
  KO
K06779  mucosal vascular addressin cell adhesion molecule 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04514  Cell adhesion molecules
pps04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100973901 (MADCAM1)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100973901 (MADCAM1)
SSDB
Motif
Pfam: Adhes-Ig_like Cornifin ig ICAM_N
Other DBs
NCBI-GeneID: 100973901
NCBI-ProteinID: XP_014197868
Position
19
AA seq 547 aa
MQGGKQATSGDRTSVRRLEEQVGGFQCVWKLRFPGLADGSCEWESSQHPFQIPLVDRDPG
LSGTPADKTRPAAPEQGGLLSTAPVQPPGKVQAGRARVGGQARKAPWEAPGEQLERGRRA
AGRSGRLYLSGFPAASGQRGLSMDFGLALLLAGLLGLLLARAAVAAGQSLQVKPLQVEPP
EPVVAVALGASRQLTCRLACADRGASVQWRGLDTSLGAVQSDTGRSVLTVRNASLSAAGT
RVCVGSCGGRTFQHTVQLLVYAFPDQLTVSPAALVPGDPAVACTAHKVTPVDPNALSFSL
LVGGQELEGAQALGPEVQEEEEEPQGDEDVLFRVTERWRLPPLGTPVPPALYCQATMRLP
GLELSHRQAIPVLHSPTSPEPPDTTSPDPPDTTSPDPPDTTSPEPPDTTSPEPPDTTSPE
PPNTTAPESPDTTSPEPAPQQGSTHTPRSPGSTRTRRPEISQAGPTQGEVIPTVSSKPAG
DQLPTALWTSSAVLGLLLLALPTYHLWKRCRHLAEDDTHPPASLRLLPQVSAWAGLRATG
QVGISPS
NT seq 1644 nt   +upstreamnt  +downstreamnt
atgcaggggggtaaacaagccaccagcggagacagaaccagtgtgcggcgcttggaggaa
caggtgggtggattccagtgcgtttggaagctgaggttcccaggactcgctgatggcagc
tgtgagtgggagtccagccagcatcccttccagatccctcttgtggaccgagatccaggt
ctcagtgggaccccagccgacaagacccggcccgcagctccggagcagggggggctgctc
tccaccgcccctgtgcagccgcccgggaaagtgcaggcaggccgggcacgggtcgggggt
caggccaggaaagccccttgggaagcccccggggagcagctggagcggggtcgccgggcg
gcgggaaggagtgggcgcctctatttaagcggcttccccgcggcctcgggacagagggga
ctgagcatggatttcggactggccctcctgctggcggggcttctggggctcctcctcgcg
agagccgcggtcgccgcaggccagtccctccaggtgaagcccctgcaggtggagcccccg
gagccggtggtggccgtggccttgggcgcctcgcgccagctcacctgccgcctggcctgc
gcggaccgcggggcctcggtgcagtggcggggcctggacaccagcctgggcgcggtgcag
tcggacacgggccgcagcgtcctcaccgtgcgcaacgcctcgctgtcggcggccgggacc
cgcgtgtgcgtgggctcctgcgggggccgcaccttccagcacaccgtgcagctccttgtg
tacgccttcccggaccagctgaccgtctccccggcagccctggtgcctggtgacccggcg
gtggcctgtacggcccacaaggtcacgcccgtggaccccaacgcgctctccttctccctg
ctcgtggggggccaggaactggagggggcgcaagccctgggcccggaggtgcaggaggag
gaggaggagccccagggggacgaggatgtgctgttcagggtgacagagcgctggcggctg
ccgcccctggggacccctgtcccgcccgccctctactgccaggccacgatgaggctgcct
ggcttggagctcagccaccgccaggccatccccgtcctgcacagcccgacctccccggag
cctcccgacaccacctccccggaccctcccgacaccacctccccggaccctcccgacacc
acctccccggagcctcccgacaccacctccccggagcctcccgacaccacctccccggag
cctcccaacacgaccgccccggagtctcccgacaccacctccccggagcccgccccccag
cagggctccacacacacccccaggagcccaggctccaccaggactcgccgccctgagatc
tcccaggctgggcccacgcagggagaagtgatcccaacagtctcgtccaaacctgcgggt
gaccagctgcccacggctctgtggaccagcagtgcagtgctgggactgctgctcctggcc
ttgcccacctatcacctctggaaacgctgccggcacctggctgaggacgacacccaccca
ccagcttctctgaggcttctgccccaggtgtcggcctgggctgggttaagggcgaccggc
caggtcgggatcagcccctcctga

DBGET integrated database retrieval system