KEGG   Pan paniscus (bonobo): 100974002
Entry
100974002         CDS       T02283                                 

Gene name
TICAM1
Definition
(RefSeq) toll like receptor adaptor molecule 1
  KO
K05842  toll-like receptor adapter molecule 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04064  NF-kappa B signaling pathway
pps04217  Necroptosis
pps04620  Toll-like receptor signaling pathway
pps04621  NOD-like receptor signaling pathway
pps05133  Pertussis
pps05135  Yersinia infection
pps05142  Chagas disease
pps05160  Hepatitis C
pps05161  Hepatitis B
pps05164  Influenza A
pps05165  Human papillomavirus infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100974002 (TICAM1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100974002 (TICAM1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100974002 (TICAM1)
   04621 NOD-like receptor signaling pathway
    100974002 (TICAM1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100974002 (TICAM1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100974002 (TICAM1)
   05160 Hepatitis C
    100974002 (TICAM1)
   05164 Influenza A
    100974002 (TICAM1)
   05168 Herpes simplex virus 1 infection
    100974002 (TICAM1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100974002 (TICAM1)
   05165 Human papillomavirus infection
    100974002 (TICAM1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100974002 (TICAM1)
   05133 Pertussis
    100974002 (TICAM1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100974002 (TICAM1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100974002 (TICAM1)
SSDB
Motif
Pfam: TRIF-NTD RHIM TIR_2
Other DBs
NCBI-GeneID: 100974002
NCBI-ProteinID: NP_001266155
UniProt: B3Y693
Position
19
AA seq 711 aa
MACTGPSLPSAFDILGAAGQDKLLYLKHKLKTPRPGCQGQDLLHAMVLLKLGQETEARIS
LEALKADAVARLVARQWAGVDSTEDPEEPPDVSWAVARLYHLLAEEKLCPASLRDVAYQE
AVRTLSSRDDHRLGELQDEARNRCGWDIAGDPGSIRTLQSNLGCLPPSSALHSGTRSLPR
PIDGVSDWSQGCSLRSTGSPASLASNLEISQSPTMPFLSLHRSPHGPSKLCDDPQASLVP
EPVPGGCQEPEEMSWPPSGEIASPPELPSSPPPGLPEVAPDATSTGLPDTPAAPETSTNY
PVECTEGSAGPQSLPLPILEPVKNPCSVKDQTPLQLSVEDTTSPNTKPCPPTPTTPETSP
PPPPPPSSTPCSAHLTPSSLFPSSLESSSEQKFYNFVILHARADEHIALRVREKLEALGV
PDGATFCEDFQVPGRGELSCLQDAIDHSAFIILLLTSNFDCRLSLHQVNQAMMSNLTRQG
SPDCVIPFLPLESSPAQLSSDTASLLSGLVRLDEHSQIFARKVANTFKPHRLQARKAMWR
KEQDTRALREQSQHLDGERMQAAALNAAYSAYLQSYLSYQAQMEQLQVAFGSHMSFGTGA
PYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSP
AFPTASPTPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE
NT seq 2136 nt   +upstreamnt  +downstreamnt
atggcctgcacgggcccatcacttcctagcgccttcgacattctaggtgcagcaggccag
gacaagctcttgtatctgaagcacaaactgaagaccccacgcccaggctgccaggggcag
gacctcctgcatgccatggttctcctgaagctgggccaggaaactgaggccaggatctct
ctagaggcattgaaggccgatgcggtggcccggctggtggcccgccagtgggctggcgtg
gacagcactgaggacccagaggagcccccagatgtgtcctgggctgtggcccgcttgtac
cacctgctggctgaggagaagctgtgcccggcctcgctgcgggacgtggcctaccaggaa
gccgtccgcaccctcagctccagggacgaccaccggctgggggaacttcaggatgaggcc
cgaaaccggtgtgggtgggacattgctggggatccagggagcatccggacgctccagtcc
aatctgggctgcctcccaccgtcctcggctttgcactctgggaccaggagcctcccacgc
cccattgacggtgtttcggactggagccaagggtgctccctgcgatccactggcagcccc
gcctccctggccagcaacttggaaatcagccagtcccccaccatgcccttcctcagcctg
caccgcagcccacatgggcccagcaagctctgtgacgacccccaggccagcttggtgccc
gagcctgtccccggtggctgccaggagcctgaggagatgagctggccgccatcgggggag
attgccagccccccagagctgccaagcagcccacctcctgggcttcccgaagtggcccca
gatgcaacctccactggcctccctgatacccccgcagctccagaaaccagcaccaactac
ccagtggagtgcactgaggggtctgcaggcccccagtctctccccttgcctattttggag
ccggtcaaaaacccctgctctgtcaaagaccagacgccactccaactttctgtagaagat
accacctctccaaataccaagccgtgcccacctactcccaccaccccagaaacatcccct
cctcctcctcctcctccttcatctaccccttgttcagctcacctgaccccctcctccctg
ttcccttcctccctggaatcatcatcggaacagaaattctataactttgtgatcctccac
gccagggcagacgaacacatcgccctgcgggttcgggagaagctagaggcccttggcgtg
cccgacggtgccaccttctgcgaggatttccaggtgccggggcgcggggagctgagctgc
ctgcaggacgccatagaccactcagctttcatcatcctacttctcacctccaacttcgac
tgtcgcctgagcctgcaccaggtgaaccaagccatgatgagcaacctcacgcgacagggg
tcgccagactgtgtcatccccttcctgcccctggagagctccccggcccagctcagctcc
gacacggccagcctgctctccgggctggtgcggctggacgaacactcccagatcttcgcc
aggaaggtggccaacaccttcaagccccacaggcttcaggcccgaaaggccatgtggagg
aaggaacaggacacccgagccctgcgggaacagagccaacacctggacggtgagcggatg
caggcggcggcactgaacgcagcctactcagcctacctccagagctacttgtcctaccag
gcacagatggagcagctccaggtggcttttgggagccacatgtcatttgggactggggcg
ccctatggggctcgaatgccctttgggggccaggtgcccctgggagccccgccacccttt
cccacttggccggggtgcccgcagccgccacccctgcacgcatggcaggctggcaccccc
ccaccgccctccccacagccagcagcctttccacagtcactgcccttcccgcagtcccca
gccttccctacggcctcacccacaccccctcagagcccagggctgcaacccctcattatc
caccacgcacagatggtacagctggggctgaacaaccacatgtggaaccagagagggtcc
caggcgcccgaggacaagacgcaggaggcggaatga

DBGET integrated database retrieval system