KEGG   Pan paniscus (bonobo): 100974224Help
Entry
100974224         CDS       T02283                                 

Gene name
MMD
Definition
(RefSeq) monocyte to macrophage differentiation associated
  KO
K11064  monocyte to macrophage differentiation protein
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    100974224 (MMD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HlyIII
Motif
Other DBs
NCBI-GeneID: 100974224
NCBI-ProteinID: XP_003817464
UniProt: A0A2R9C4U9
Position
17
AA seq 238 aa AA seqDB search
MRFKNRFQRFMNHRAPANGRYKPTCYEHAANCYTHAFLIVPAIVGSALLHRLSDDCWEKI
TAWIYGMGLCALFIVSTVFHIVSWKKSHLRTVEHCFHMCDRMVIYFFIAASYAPWLNLRE
LGPLASHMRWFIWLMAAGGTIYVFLYHEKYKVVELFFYLTMGFSPALVVTSMNNTDGLQE
LACGGLIYCLGVVFFKSDGIIPFAHAIWHLFVATAAAVHYYAIWKYLYRSPTDFMRHL
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgcggttcaagaatcgattccagcggttcatgaaccatcgagctccagccaatggccgc
tacaagccaacttgctatgaacatgctgctaactgttacacacacgcattcctcattgtt
ccggccatcgtgggcagtgccctcctccatcggctgtctgatgactgctgggaaaagata
acagcatggatttatggaatgggactctgtgccctcttcatcgtttctacagtatttcac
attgtatcatggaaaaagagccacttaaggacagtggagcattgttttcacatgtgtgat
agaatggttatctatttcttcattgctgcttcttatgctccatggttaaatcttcgtgaa
cttggacccctggcatctcatatgcgttggtttatctggctcatggcagctggaggaacc
atttatgtatttctctaccatgaaaaatataaggtggttgaactctttttctatctcaca
atgggattctctccagccttggtggtgacatcaatgaacaacaccgatggacttcaggaa
cttgcctgtgggggcttaatttattgcttgggagttgtgttcttcaagagtgatggcatc
attccatttgcccacgccatctggcacctgtttgtggccacggcagctgcagtgcattac
tacgccatttggaaatacctttaccgaagtcctacggactttatgcggcatttatga

DBGET integrated database retrieval system