KEGG   Pan paniscus (bonobo): 100974265
Entry
100974265         CDS       T02283                                 

Gene name
IL23A
Definition
(RefSeq) interleukin 23 subunit alpha
  KO
K05426  interleukin 23 subunit alpha
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04625  C-type lectin receptor signaling pathway
pps04630  JAK-STAT signaling pathway
pps04659  Th17 cell differentiation
pps05133  Pertussis
pps05152  Tuberculosis
pps05200  Pathways in cancer
pps05321  Inflammatory bowel disease
pps05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100974265 (IL23A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100974265 (IL23A)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100974265 (IL23A)
   04659 Th17 cell differentiation
    100974265 (IL23A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100974265 (IL23A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100974265 (IL23A)
   05152 Tuberculosis
    100974265 (IL23A)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100974265 (IL23A)
   05321 Inflammatory bowel disease
    100974265 (IL23A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100974265 (IL23A)
Cytokines and growth factors [BR:pps04052]
 Cytokines
  Interleukins
   100974265 (IL23A)
SSDB
Motif
Pfam: IL23 IL6
Other DBs
NCBI-GeneID: 100974265
NCBI-ProteinID: XP_003824971
UniProt: A0A2R9CIV0
Position
12
AA seq 189 aa
MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEG
DEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSP
VGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVF
AHGAATLSP
NT seq 570 nt   +upstreamnt  +downstreamnt
atgctggggagcagagctgtaatgctgctattgctgctgccctggacagctcagggcaga
gctgtgcctgggggcagcagccctgcctggactcagtgccagcagctttcacagaagctc
tgcacactggcctggagtgcacatccactagtgggacacatggatctaagagaagaggga
gatgaagagactacaaatgatgttccccatatccagtgtggagatggctgtgacccccaa
ggactcagggacaacagtcagttctgcttgcaaaggatccaccagggtctgattttttat
gagaagctgctaggatcggatattttcacaggggagccttctctgctccctgatagccct
gtgggccagcttcatgcctccctactgggcctcagccaactcctgcagcctgagggtcac
cactgggagactcagcagattccaagcctcagtcccagccagccatggcagcgtctcctt
ctccgcttcaaaatccttcgcagcctccaggcctttgtggctgtagccgcccgggtcttt
gcccatggagcagcaaccctgagtccctaa

DBGET integrated database retrieval system