KEGG   Pan paniscus (bonobo): 100974274
Entry
100974274         CDS       T02283                                 

Gene name
CD40
Definition
(RefSeq) CD40 molecule
  KO
K03160  tumor necrosis factor receptor superfamily member 5
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04064  NF-kappa B signaling pathway
pps04514  Cell adhesion molecules
pps04620  Toll-like receptor signaling pathway
pps04672  Intestinal immune network for IgA production
pps05144  Malaria
pps05145  Toxoplasmosis
pps05166  Human T-cell leukemia virus 1 infection
pps05169  Epstein-Barr virus infection
pps05202  Transcriptional misregulation in cancer
pps05310  Asthma
pps05320  Autoimmune thyroid disease
pps05322  Systemic lupus erythematosus
pps05330  Allograft rejection
pps05340  Primary immunodeficiency
pps05416  Viral myocarditis
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100974274 (CD40)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100974274 (CD40)
   04514 Cell adhesion molecules
    100974274 (CD40)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100974274 (CD40)
   04672 Intestinal immune network for IgA production
    100974274 (CD40)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100974274 (CD40)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100974274 (CD40)
   05169 Epstein-Barr virus infection
    100974274 (CD40)
  09174 Infectious disease: parasitic
   05144 Malaria
    100974274 (CD40)
   05145 Toxoplasmosis
    100974274 (CD40)
  09163 Immune disease
   05310 Asthma
    100974274 (CD40)
   05322 Systemic lupus erythematosus
    100974274 (CD40)
   05320 Autoimmune thyroid disease
    100974274 (CD40)
   05330 Allograft rejection
    100974274 (CD40)
   05340 Primary immunodeficiency
    100974274 (CD40)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100974274 (CD40)
   05416 Viral myocarditis
    100974274 (CD40)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pps04050]
    100974274 (CD40)
   04090 CD molecules [BR:pps04090]
    100974274 (CD40)
Cytokine receptors [BR:pps04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100974274 (CD40)
CD molecules [BR:pps04090]
 Proteins
  100974274 (CD40)
SSDB
Motif
Pfam: TNFR_c6 RANK_CRD_2 DUF6479 Glycophorin_A DUF2207 Syndecan
Other DBs
NCBI-GeneID: 100974274
NCBI-ProteinID: XP_003826048
UniProt: A0A2R9C4Y2
Position
20
AA seq 277 aa
MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECL
PCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGRHCTSEACESCV
LHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTN
KTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPD
DLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
NT seq 834 nt   +upstreamnt  +downstreamnt
atggttcgtctgcctctgcagtgcgtcctctggggctgcttgctgaccgctgtccatcca
gaaccacccactgcatgcagagaaaaacagtacctaataaacagtcagtgctgttctttg
tgccagccaggacagaaactggtgagtgactgcacagagttcactgaaacggaatgcctt
ccttgcggtgaaagcgaattcctagacacctggaacagagagacacactgccaccagcac
aaatactgcgaccccaacctagggcttcgggtccagcagaagggcacctcagaaacagac
accatctgcacctgtgaagaaggccggcactgtacgagtgaggcctgtgagagctgtgtc
ctgcaccgctcatgctcgcccggctttggggtcaagcagattgctacaggggtttctgat
accatctgcgagccctgcccagtcggcttcttctccaatgtgtcatctgctttcgaaaaa
tgtcacccttggacaagctgtgagaccaaagacctggttgtgcaacaggcaggcacaaac
aagactgatgttgtctgtggtccccaggatcggctgagagccctggtggtgatccccatc
atcttcgggatcctgtttgccatcctcttggtgctggtctttatcaaaaaggtggccaag
aagccaaccaataaggccccccaccccaagcaggaaccccaggagatcaattttcccgac
gatcttcctggctccaacactgccgctccagtgcaggagactttacatggatgccaaccg
gtcacccaggaggatggcaaagagagtcgcatctcagtgcaggagagacagtga

DBGET integrated database retrieval system