KEGG   Pan paniscus (bonobo): 100974281
Entry
100974281         CDS       T02283                                 

Gene name
NFATC1
Definition
(RefSeq) nuclear factor of activated T-cells 1
  KO
K04446  nuclear factor of activated T-cells, cytoplasmic 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04024  cAMP signaling pathway
pps04218  Cellular senescence
pps04310  Wnt signaling pathway
pps04380  Osteoclast differentiation
pps04625  C-type lectin receptor signaling pathway
pps04650  Natural killer cell mediated cytotoxicity
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04660  T cell receptor signaling pathway
pps04662  B cell receptor signaling pathway
pps04921  Oxytocin signaling pathway
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps05135  Yersinia infection
pps05161  Hepatitis B
pps05163  Human cytomegalovirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05170  Human immunodeficiency virus 1 infection
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pps05321  Inflammatory bowel disease
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100974281 (NFATC1)
   04310 Wnt signaling pathway
    100974281 (NFATC1)
   04024 cAMP signaling pathway
    100974281 (NFATC1)
   04022 cGMP-PKG signaling pathway
    100974281 (NFATC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100974281 (NFATC1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100974281 (NFATC1)
   04650 Natural killer cell mediated cytotoxicity
    100974281 (NFATC1)
   04660 T cell receptor signaling pathway
    100974281 (NFATC1)
   04658 Th1 and Th2 cell differentiation
    100974281 (NFATC1)
   04659 Th17 cell differentiation
    100974281 (NFATC1)
   04662 B cell receptor signaling pathway
    100974281 (NFATC1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100974281 (NFATC1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100974281 (NFATC1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100974281 (NFATC1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100974281 (NFATC1)
   05170 Human immunodeficiency virus 1 infection
    100974281 (NFATC1)
   05161 Hepatitis B
    100974281 (NFATC1)
   05163 Human cytomegalovirus infection
    100974281 (NFATC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100974281 (NFATC1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100974281 (NFATC1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100974281 (NFATC1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100974281 (NFATC1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100974281 (NFATC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pps03000]
    100974281 (NFATC1)
Transcription factors [BR:pps03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    100974281 (NFATC1)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 100974281
NCBI-ProteinID: XP_014197850
Position
18
AA seq 536 aa
MSPTLPALDWQLPSHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYL
ENEPLMLQLFIGTADDRLLRPHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENSM
RAVIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHVPQPSGRTLSLQVASNPIEC
SQRSAQELPLVEKQSTDSYPVVGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTD
RDLCKPNSLVVEIPPFRNQRITSPVHVSFYVCNGKRKRSQYQRFTYLPANVPIIKTEPTD
DYEPAPTCGPVSQGLSPLPRPYYSQQLAMPPDPSSCLVAGFPPCPQRSTLMPAAPGVSPK
LHDLSPAAYTKGVASPGHCHLGLPQPAGEAPAVQDVPRPVATHPGSPAXITSYSIPQQVS
APPSSSXPPGLEHSLCPSSPSPPLPPATQEPTCLQPCSPACPPATGRPQHPPSTVRRDKS
PTAGPRLLPEVHEDGSPNLAPIPVTVKREPEELDQLYLDDVNEIIRNDLSSTNTHS
NT seq 1611 nt   +upstreamnt  +downstreamnt
atgagcccgaccctgcccgccctggactggcagctgccgtcccactcaggcccgtatgag
cttcggattgaggtgcagcccaagtcccaccaccgagcccactacgagacggagggcagc
cggggggccgtgaaggcgtcggccggaggacaccccatcgtgcagctgcacggctacttg
gagaatgagccgctgatgttgcagcttttcattgggacggcggacgaccgcctgctgcgc
ccgcacgccttctaccaggtgcaccgcatcacagggaagaccgtgtccaccaccagccac
gaggccatcctctccaacaccaaagtcctggagatcccactcctgccggagaacagcatg
cgagccgtcattgactgtgccggaatcctgaaactcagaaactccgacattgaacttcgg
aaaggagagacggacatcgggaggaagaacacacgggtacggctggtgttccgcgttcac
gtcccgcagcccagcggccgcacgctgtccctgcaggtggcctccaaccccatcgaatgc
tcccagcgctcagctcaggagctgcctctggtggagaagcagagcacggacagctatccg
gtcgtgggcgggaagaagatggtcctgtccggccacaacttcctgcaggactccaaggtc
attttcgtggagaaagccccagatggccaccacgtctgggagatggaagcgaaaactgac
cgggacctgtgcaagccgaattctctggtggttgagatcccgccgtttcggaatcagagg
ataaccagccccgttcacgtcagtttctacgtctgcaacgggaagagaaagcgaagccag
taccagcgtttcacctaccttcccgccaacgttccaattataaaaacagaacccactgat
gattatgagcctgctccaacctgtggaccagtgagccaggggttaagtcctctcccaaga
ccatactacagccagcagctcgcaatgccacccgaccccagctcctgcctcgtggccggc
ttcccgccctgtccgcagagaagcaccctgatgccagcggcccccggcgtgagccccaag
ctccacgacctttctcccgctgcctacaccaagggcgttgccagcccgggccactgtcac
ctcggactcccgcagccggccggagaggcccctgccgtccaggacgtgcccaggccagtg
gccacgcaccccggctcgcccgcgntaataacttcgtatagcataccacagcaggtgagt
gcgcctccaagcagtagcntcccccctggtctcgaacactcgctgtgccccagcagcccc
tctcctccactcccgcctgccacccaagagccgacctgcctgcagccctgcagcccagcg
tgcccgcccgccacgggccgcccgcagcacccgccgtccacggtccgcagggacaagtct
ccgactgccgggccacggctgctgccagaggtgcatgaggacggtagtcctaatttggcc
cctattcctgtaacagtcaagcgagagcctgaagagttggaccagttgtacctggatgac
gtaaatgaaataatacgaaatgacctctccagcacgaacacccactcctag

KEGG   Pan paniscus (bonobo): 100980286
Entry
100980286         CDS       T02283                                 

Gene name
NFATC2
Definition
(RefSeq) nuclear factor of activated T-cells 2
  KO
K17332  nuclear factor of activated T-cells, cytoplasmic 2
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04022  cGMP-PKG signaling pathway
pps04218  Cellular senescence
pps04310  Wnt signaling pathway
pps04360  Axon guidance
pps04370  VEGF signaling pathway
pps04380  Osteoclast differentiation
pps04625  C-type lectin receptor signaling pathway
pps04650  Natural killer cell mediated cytotoxicity
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04660  T cell receptor signaling pathway
pps04662  B cell receptor signaling pathway
pps04921  Oxytocin signaling pathway
pps05135  Yersinia infection
pps05161  Hepatitis B
pps05163  Human cytomegalovirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05170  Human immunodeficiency virus 1 infection
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100980286 (NFATC2)
   04370 VEGF signaling pathway
    100980286 (NFATC2)
   04022 cGMP-PKG signaling pathway
    100980286 (NFATC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100980286 (NFATC2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100980286 (NFATC2)
   04650 Natural killer cell mediated cytotoxicity
    100980286 (NFATC2)
   04660 T cell receptor signaling pathway
    100980286 (NFATC2)
   04658 Th1 and Th2 cell differentiation
    100980286 (NFATC2)
   04659 Th17 cell differentiation
    100980286 (NFATC2)
   04662 B cell receptor signaling pathway
    100980286 (NFATC2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100980286 (NFATC2)
  09158 Development and regeneration
   04360 Axon guidance
    100980286 (NFATC2)
   04380 Osteoclast differentiation
    100980286 (NFATC2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100980286 (NFATC2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100980286 (NFATC2)
   05170 Human immunodeficiency virus 1 infection
    100980286 (NFATC2)
   05161 Hepatitis B
    100980286 (NFATC2)
   05163 Human cytomegalovirus infection
    100980286 (NFATC2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100980286 (NFATC2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100980286 (NFATC2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100980286 (NFATC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pps03000]
    100980286 (NFATC2)
Transcription factors [BR:pps03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    100980286 (NFATC2)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 100980286
NCBI-ProteinID: XP_003815318
UniProt: A0A2R9C1U2
Position
20
AA seq 901 aa
MQREAAFRLGHCHPLRIMGSVDQEEPNAHKVASPPSGPAYPDDVLDYGLKPYSPLASLSG
ESPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQP
PLAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFISDTFSPYTSPCVSPNNGGPDD
LCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPVPRPASRSSSPGAKRRHSCAEAL
VALPPGASPQRSRSPSPQPSSHVAPQDHGAPAGYPPVAGSAVIMDALNSLATDSPCGVPP
KMWKTSPDPSPVSAAPSKAGLPRHIYPAVEFLGPCEQGERRNSAPESILLVPPTWPKPLV
PAIPICSIPVTASLPPLEWPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGH
PVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTKVLE
IPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSL
QTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTDGQQ
IWEMEATVDKDKSQPNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPVPA
IKTEPTDEYDPTLICSPTHGGLGSQSYYPQHPMVAESPSCLVATMAPCQQFRTGLSSPDA
RYQQQNPAAVLYQRSKSLSPSLLGYQQPALMAAPLSLADAHRSVLVHAGSQGQSSALLHP
SPTNQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPGTTRPGPPPVSQGQRLSPGSY
PTVIQQQNATSQRAAKNGPPVSDQKEVLPSGVTIKQEQNLDQTYLDDELIDTHLSWIQNI
L
NT seq 2706 nt   +upstreamnt  +downstreamnt
atgcagagagaggctgcgttcagactggggcactgccatcccctccgcatcatggggtct
gtggaccaagaagagccgaatgcacataaggtcgccagcccaccctccggacccgcatac
cccgatgatgtcctggactatggcctcaagccatacagcccccttgctagtctctctggc
gagtcccccggtcgattcggagagccggatagggtagggccgcagaagtttctgagcgcg
gccaagccagcaggggcctcgggcctgagccctcggatcgagatcactccgtcccacgaa
ctgatccaggcagtggggcccctccgcatgagagacgcgggcctcctggtggagcagccg
cccctggccggggtggccgccagcccgaggttcaccctgcccgtgcccggcttcgagggc
taccgcgagccgctttgcttgagccccgctagcagcggctcctctgccagcttcatttct
gacaccttctccccctacacctcgccctgcgtctcgcccaataacggcgggcccgacgac
ctgtgtccgcagtttcaaaacatccctgctcattattcccccagaacctcgccaataatg
tcacctcgaaccagcctcgccgaggacagctgcctgggccgccactcgcccgtgccccgt
ccggcctcccgctcctcatcgcctggtgccaagcggaggcattcgtgcgccgaggccttg
gttgccctgccgcccggagcctcaccccagcgctcccggagcccctcgccgcagccctca
tctcacgtggcaccccaggaccacggcgccccggctgggtacccccctgtggctggctct
gccgtgatcatggatgccctgaacagcctcgccacggactcgccttgtggggtccccccc
aagatgtggaagaccagccctgacccctcgccggtgtctgccgccccatccaaggccggc
ctgcctcgccacatctacccggccgtggagttcctggggccctgcgagcagggggagagg
agaaactcggctccagaatccatcctgctggttccgcccacttggcccaagccgctggtg
cctgccattcccatctgcagcatcccagtgactgcatccctccctccacttgagtggccg
ctgtccagtcagtcaggctcttatgagctgcggatcgaggtgcagcccaagccacatcac
cgggcccactatgagacagaaggcagccgaggggctgtcaaagctccaactggaggccac
cctgtggttcagctccatggctacatggaaaacaagcctctgggacttcagatcttcatt
gggacagctgatgagcggatccttaagccgcacgccttctaccaggtgcaccgaatcaca
gggaaaactgtcaccaccaccagctatgagaagatagtgggcaacaccaaagtcctggag
atccccttggagcccaaaaacaacatgagggcaaccatcgactgtgcggggatcttgaag
cttagaaacgccgacattgagctgcggaaaggcgagacggacattggaagaaagaacacg
cgggtgaggctggttttccgagttcacatcccagagtccagtggcagaatcgtctcttta
cagactgcatctaaccccatcgagtgctcccagcgatctgctcacgagctgcccatggtt
gaaagacaagacacagacagctgcctggtctatggcggccagcaaatgatcctcacgggg
cagaactttacatccgagtccaaagttgtgtttactgagaagaccacagatggacagcaa
atttgggagatggaagccacggtggataaggacaagagccagcccaacatgctttttgtt
gagatccctgaatatcggaacaagcatatccgcacacctgtaaaagtgaacttctacgtc
atcaatgggaagagaaaacgaagtcagcctcagcactttacctaccacccagtcccagcc
atcaagacggagcccacggatgaatatgaccccactctgatctgcagccccacccatgga
ggcctggggagccagtcttactacccccagcacccgatggtggccgagtccccctcctgc
ctcgtggccaccatggctccctgccagcagttccgcacggggctctcatcccctgacgcc
cgctaccagcaacagaacccagcggccgtactctaccagcggagcaagagcctgagcccc
agcctgctgggctatcagcagccggccctcatggccgccccgctgtcccttgcggacgct
caccgctctgtgctggtgcacgccggctcccagggccagagctcagccctgctccacccc
tctccgaccaaccagcaggcctcgcctgtgatccactactcacccaccaaccagcagctg
cgctgcggaagccaccaggagttccagcacatcatgtactgcgagaatttcgcaccaggc
accaccaggcctggcccgcccccggtcagtcaaggtcagaggctgagcccgggttcctac
cccacagtcattcagcagcagaatgccacgagccaaagagccgccaaaaacggacccccg
gtcagtgaccaaaaggaagtattaccttcgggggtgaccattaaacaggagcagaacttg
gaccagacctacttggatgatgagctgatagacacacaccttagctggatacaaaacata
ttatga

KEGG   Pan paniscus (bonobo): 100988212
Entry
100988212         CDS       T02283                                 

Gene name
NFATC3
Definition
(RefSeq) nuclear factor of activated T-cells 3
  KO
K17333  nuclear factor of activated T-cells, cytoplasmic 3
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04218  Cellular senescence
pps04310  Wnt signaling pathway
pps04360  Axon guidance
pps04625  C-type lectin receptor signaling pathway
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04660  T cell receptor signaling pathway
pps04662  B cell receptor signaling pathway
pps04921  Oxytocin signaling pathway
pps05135  Yersinia infection
pps05161  Hepatitis B
pps05163  Human cytomegalovirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05170  Human immunodeficiency virus 1 infection
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100988212 (NFATC3)
   04310 Wnt signaling pathway
    100988212 (NFATC3)
   04022 cGMP-PKG signaling pathway
    100988212 (NFATC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100988212 (NFATC3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100988212 (NFATC3)
   04660 T cell receptor signaling pathway
    100988212 (NFATC3)
   04658 Th1 and Th2 cell differentiation
    100988212 (NFATC3)
   04659 Th17 cell differentiation
    100988212 (NFATC3)
   04662 B cell receptor signaling pathway
    100988212 (NFATC3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100988212 (NFATC3)
  09158 Development and regeneration
   04360 Axon guidance
    100988212 (NFATC3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100988212 (NFATC3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100988212 (NFATC3)
   05170 Human immunodeficiency virus 1 infection
    100988212 (NFATC3)
   05161 Hepatitis B
    100988212 (NFATC3)
   05163 Human cytomegalovirus infection
    100988212 (NFATC3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100988212 (NFATC3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100988212 (NFATC3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100988212 (NFATC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pps03000]
    100988212 (NFATC3)
Transcription factors [BR:pps03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    100988212 (NFATC3)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 100988212
NCBI-ProteinID: XP_008965530
Position
16
AA seq 1170 aa
MLSREQLRGPASGDKDAATGAKAPPRRGWACGDRELRVRTCRAICLLRFHPNLAGLSVRS
LPSGDSAIKVEFFIVLHHFISVTSDIKLITFIHLFSVPVPGLQTPSPLVFSNLEPDDCAS
IYIFNVDPPPSTLNTPLCLPHHGLPSHSSVLSPSFQLQSHKNYEGTCEIPESKYSPLGGP
KPFECPSIQITSISPNCHQELDAHEDDLQINDPEREFLERPSRDHLYLPLEPSYRESSLS
PSPASSISSRSWFSDASSCESLSHIYDDVDSELNEAAARFTLGSPLTSPGGSPGGCPGEE
TWHQQYGLGHSLSPRQSPCHSPRSSVTDENWLSPRPASGPSSRPTSPCGKRRHSSAEVCY
AGSLSPHHSPVPSPGHSPRGSVTEDTWLNASVHGGSGLGPAVFPFQYCVETDIPLKTRKT
SEDQAAILPGKLELCSDDQGSLSPARETSIDDGLGSQYPLKKDSCGDQFLSVPSPFTWSK
PKPGHTPIFRTSSLPPLDWPLPAHFGQCELKIEVQPKTHHRAHYETEGSRGAVKASTGGH
PVVKLLGYNEKPINLQMFIGTADDRYLRPHAFYQVHRITGKTVATASQEIIIASTKVLEI
PLLPENNMSASIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQPSGKVLSLQ
IASIPVECSQRSAQELPHIEKYSINSCSVNGGHEMIVTGSNFLPESKIIFLEKGQDGRPQ
WEVEGKIIREKCQGAHIVLEVPPYHNPAVTAAVQVHFYLCNGKRKKSQSQRFTYTPVLMK
HEHREETDLSSVPSLPVPHPAQTQRPSSDSGCSHDSVLSGQRSLICSIPQTYASMVTSSH
LPQLQCRDESVSKEQHMIPSPIVHQPFQVTPTPPVGSSYQPMQSNVVYNGPTCLPINAAS
SQEFDSVLFQQDATLSGLVNLGCQPLSSIPFHSSNSGSTGHLLAHTPHSVHTLPHLQSMG
YHCSNTGQRSLSSPVADQITGQPSSQLQPITYGPSHSGSATTASPAASHPLASSPLSGPP
SPQLQPMPYQSPSSGTASSPSPATRMHSGQHSTQAQSTGQGGLSAPSSLICHSLCDPASF
PPDGATVSIKPEPEDREPNFATIGLQDITLDDVETYVLASPSRKISEESRVNEIIGRDMS
QISVSQGAGVSRQAPLPSPESLDLGRSDGL
NT seq 3513 nt   +upstreamnt  +downstreamnt
atgctgtcaagggagcagctgcgggggcccgctagtggggacaaagacgcagccaccggg
gcgaaagctccgccccgcagagggtgggcctgcggcgaccgcgagctcagagtccggact
tgtcgcgcaatctgtctccttcggttccaccccaacctagctggactctcggtccggtcc
ctgccctctggagactcagccattaaagttgagtttttcattgtgctccaccattttata
tctgttacttcagatatcaagctcatcacctttattcatctcttttcagtcccagtccca
ggacttcagactcctagtcctttggtcttctccaatcttgagccagatgattgtgcatcc
atttacatctttaatgtagatccacctccatctactttaaacacaccactttgcttacca
catcatggattaccgtctcactcttctgttttgtcaccatcgtttcagctccaaagtcac
aaaaactatgaaggaacttgtgagattcctgaatctaaatatagcccattaggtggtccc
aaaccctttgagtgcccaagtattcaaattacatctatctctcctaactgtcatcaagaa
ttagatgcacatgaagatgacctacagataaatgacccagaacgggaatttttggaaagg
ccttctagagatcatctctatcttcctcttgagccatcctaccgggagtcttctcttagt
cctagtcctgccagcagcatctcttctaggagttggttctctgatgcatcttcttgtgaa
tcgctttcacatatttatgatgatgtggactcagagttgaatgaagctgcagcccgattt
acccttggatcccctctgacttctcctggtggctctccagggggctgccctggagaagaa
acttggcatcaacagtatggacttggacactcattatcacccaggcaatctccttgccac
tctcctagatccagtgtcactgatgagaattggctgagccccaggccagcctcaggaccc
tcatcaaggcccacatccccctgtgggaaacggaggcactccagtgctgaagtttgttat
gctgggtccctttcaccccatcactcacctgttccttctcctggtcactcccccagggga
agtgtgacagaagatacgtggctcaatgcttctgtccatggtgggtcaggccttggccct
gcagtttttccatttcagtactgtgtagagactgacatccctctcaaaacaaggaaaact
tctgaagatcaagctgccatactaccaggaaaattagagctgtgttcagatgaccaaggg
agtttatcaccagcccgggagacttcaatagatgatggccttggatctcagtatccttta
aagaaagattcatgtggtgatcagtttctttcagttccttcaccctttacctggagcaaa
ccaaagcctggccacacccctatatttcgcacatcttcattacctccactagactggcct
ttaccagctcattttggacaatgtgaactgaaaatagaagtgcaacctaaaactcatcat
cgagcccattatgaaactgaaggtagccgaggggcagtaaaagcatctactgggggacat
cctgttgtgaagctcctgggctataacgaaaagccaataaatctacaaatgtttattggg
acagcagatgatcgatatttacgacctcatgcattttaccaggtgcatcgaatcactggg
aagacagtcgctactgcaagccaagagataataattgccagtacaaaagttctggaaatt
ccacttcttcctgaaaacaatatgtcagccagtattgattgtgcaggtattttgaaactc
cgcaattcagatatagaacttcgaaaaggagaaactgatattggcagaaagaatactaga
gtacgacttgtgtttcgtgtacacatcccacagcccagtggaaaagtcctttctctgcag
atagcctctatacccgttgagtgctcccagcggtctgctcaagaacttcctcatattgag
aagtacagtatcaacagttgttctgtaaatggaggtcatgaaatgattgtgactggatct
aattttcttccagaatccaaaatcatttttcttgaaaaaggacaagatggacgacctcag
tgggaggtagaagggaagataatcagggaaaaatgtcaaggggctcacattgtccttgaa
gttcctccatatcataacccagcagttacagctgcagtgcaggtgcacttttatctttgc
aatggcaagaggaaaaaaagccagtctcaacgttttacttatacaccagttttgatgaag
catgaacacagagaagagactgatttgtcttcagttccatctttgcctgtgcctcatcct
gctcagacccagaggccttcctctgattcagggtgttcacatgacagtgtactgtcagga
cagagaagtttgatttgttccatcccacaaacatatgcatccatggtgacctcatcccat
ctgccacagttgcagtgtagagatgagagtgttagtaaagaacagcatatgattccttct
ccaattgtacaccagccttttcaagtcacaccaacacctcctgtggggtcttcctatcag
cctatgcaaagtaatgttgtgtacaatggaccaacttgtcttcctattaatgctgcctct
agtcaagaatttgattcagttttgtttcagcaggatgcaactctttctggtttagtgaat
cttggctgtcaaccactgtcatccataccatttcattcttcgaattcaggctcaacagga
catctcttagcccatacacctcattctgtgcataccctgcctcatctgcaatcaatggga
tatcattgttcaaatacaggacaaagatctctttcttctccagtggctgaccagattaca
ggtcagccttcgtctcagttacaacctattacatatggtccttcacattcagggtctgct
acaacagcttccccagcagcttctcatcccttggctagttcaccgctttctgggccacca
tctcctcagcttcagcctatgccttaccaatctcctagctcaggaactgcctcatcaccg
tctccagccaccagaatgcattctggacagcactcaactcaagcacaaagtacgggccag
gggggtctttctgcaccttcatccttaatatgtcacagtttgtgtgatccagcttcattt
ccacctgatggggcaactgtgagcattaaacctgaaccagaagatcgagagcctaacttt
gcaaccattggtctgcaggacatcactttagatgatgttgagacctacgttttggccagt
cccagcaggaagatatctgaggaatctagagtgaacgagataattgggagagacatgtcc
cagatttctgtttcccaaggagcaggggtgagcaggcaggctcccctcccaagtcctgag
tccctggatttaggaagatctgatgggctctaa

DBGET integrated database retrieval system