KEGG   Pan paniscus (bonobo): 100974396
Entry
100974396         CDS       T02283                                 

Gene name
CCL25
Definition
(RefSeq) C-C motif chemokine ligand 25
  KO
K13072  C-C motif chemokine 25
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04061  Viral protein interaction with cytokine and cytokine receptor
pps04062  Chemokine signaling pathway
pps04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100974396 (CCL25)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100974396 (CCL25)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100974396 (CCL25)
   04062 Chemokine signaling pathway
    100974396 (CCL25)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100974396 (CCL25)
Cytokines and growth factors [BR:pps04052]
 Cytokines
  Chemokines
   100974396 (CCL25)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100974396
NCBI-ProteinID: XP_008960608
UniProt: A0A2R9AG69
Position
19
AA seq 150 aa
MNLWLLACLVAGFLGAWAPAVHTQGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNL
PAAIFYLPKRHRKVCGNPKSREVQKAMKLLDARNKVFAKLRHNTQTFQAGPHAVKKLSSG
SSKLSSSKFSNPISSSKRNVSLLISANSGL
NT seq 453 nt   +upstreamnt  +downstreamnt
atgaacctgtggctcctggcctgcctggtggccggcttcctgggagcctgggcccccgct
gtccacacccaaggtgtctttgaggactgctgcctggcctaccactaccccattgggtgg
gctgtgctccggcgcgcctggacttaccggatccaggaggtgagcgggagctgcaatctg
cctgctgcgatattctacctccccaagagacacaggaaggtgtgtgggaaccccaaaagc
agggaggtgcagaaagccatgaagctcctggatgctcgaaataaggtttttgcaaagctc
cgccacaacacgcagaccttccaagcaggccctcatgctgtaaagaagttgagttctgga
agctccaagttatcatcgtccaagtttagcaatcccatcagcagcagcaagaggaatgtc
tccctcctgatatcagctaattcaggactgtga

DBGET integrated database retrieval system