KEGG   Pan paniscus (bonobo): 100974444
Entry
100974444         CDS       T02283                                 

Gene name
CXCL12
Definition
(RefSeq) C-X-C motif chemokine ligand 12
  KO
K10031  C-X-C motif chemokine 12
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04061  Viral protein interaction with cytokine and cytokine receptor
pps04062  Chemokine signaling pathway
pps04064  NF-kappa B signaling pathway
pps04360  Axon guidance
pps04670  Leukocyte transendothelial migration
pps04672  Intestinal immune network for IgA production
pps04810  Regulation of actin cytoskeleton
pps05163  Human cytomegalovirus infection
pps05200  Pathways in cancer
pps05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100974444 (CXCL12)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100974444 (CXCL12)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100974444 (CXCL12)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100974444 (CXCL12)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100974444 (CXCL12)
   04672 Intestinal immune network for IgA production
    100974444 (CXCL12)
   04062 Chemokine signaling pathway
    100974444 (CXCL12)
  09158 Development and regeneration
   04360 Axon guidance
    100974444 (CXCL12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100974444 (CXCL12)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100974444 (CXCL12)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100974444 (CXCL12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100974444 (CXCL12)
   00536 Glycosaminoglycan binding proteins [BR:pps00536]
    100974444 (CXCL12)
Cytokines and growth factors [BR:pps04052]
 Cytokines
  Chemokines
   100974444 (CXCL12)
Glycosaminoglycan binding proteins [BR:pps00536]
 Heparan sulfate / Heparin
  Chemokines
   100974444 (CXCL12)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100974444
NCBI-ProteinID: XP_003816792
Position
10
AA seq 93 aa
MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIV
ARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaacgccaaggtcgtggtcgtgctggtcctcgtgctgaccgcgctctgcctcagcgac
gggaagcccgtcagcctgagctacagatgcccatgccgattcttcgaaagccatgttgcc
agagccaacgtcaagcatctcaaaattctcaacactccaaactgtgcccttcagattgta
gcccggctgaagaacaacaacagacaagtgtgcattgacccgaagctaaagtggattcag
gagtacctggagaaagctttaaacaagaggttcaagatgtga

DBGET integrated database retrieval system